Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6U9T6

Protein Details
Accession A0A0L6U9T6   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-89NQYNRENKEKKRLSDKKRYLAKSKRNPHydrophilic
NLS Segment(s)
PositionSequence
70-89KEKKRLSDKKRYLAKSKRNP
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences TPQENSELVKHYLRVLKLRKEEYIRNYKPSDWELLTREEQLILATYHAHLRDEESLETQLLINQYNRENKEKKRLSDKKRYLAKSKRNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.52
5 0.55
6 0.56
7 0.56
8 0.6
9 0.6
10 0.64
11 0.59
12 0.57
13 0.56
14 0.51
15 0.49
16 0.44
17 0.4
18 0.3
19 0.3
20 0.26
21 0.28
22 0.28
23 0.25
24 0.22
25 0.18
26 0.16
27 0.13
28 0.11
29 0.07
30 0.06
31 0.06
32 0.06
33 0.08
34 0.08
35 0.08
36 0.07
37 0.09
38 0.11
39 0.13
40 0.13
41 0.13
42 0.13
43 0.13
44 0.13
45 0.11
46 0.1
47 0.1
48 0.11
49 0.1
50 0.12
51 0.17
52 0.24
53 0.28
54 0.34
55 0.4
56 0.45
57 0.55
58 0.6
59 0.62
60 0.67
61 0.74
62 0.75
63 0.8
64 0.84
65 0.83
66 0.85
67 0.86
68 0.85
69 0.85