Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6V1H6

Protein Details
Accession A0A0L6V1H6   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAHSRRLPNPKPKKLPKCPPEAIKTGHydrophilic
NLS Segment(s)
PositionSequence
11-14KPKK
Subcellular Location(s) nucl 18, mito_nucl 13.333, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MAHSRRLPNPKPKKLPKCPPEAIKTGIQKNLRARNPITYGLASRRSRYSPSLLNKSPLVKGQTTATSNLKAGCVLQNKCKGALQKIYINMKFLLDQSGYMGCADSGKPMISKTGNTLNKPHSVVKLAHLLFTCTYATGKNVLLPGVNPTEDTKNYPTTENTSPDKHLSLLKKKKQLVDSSSDEDTVEVIPTHCPPPPKRVQGSKYDIFKSGVESLVGEIREMGSHPKDDIKSTVNKNSMGLPSVLENDANAEVPVSLAETTNQMVCKAWLEDTITKMEQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.92
4 0.91
5 0.88
6 0.86
7 0.82
8 0.76
9 0.69
10 0.66
11 0.66
12 0.62
13 0.6
14 0.55
15 0.54
16 0.58
17 0.64
18 0.61
19 0.59
20 0.55
21 0.56
22 0.57
23 0.54
24 0.49
25 0.41
26 0.39
27 0.39
28 0.46
29 0.4
30 0.39
31 0.4
32 0.39
33 0.41
34 0.41
35 0.41
36 0.41
37 0.48
38 0.54
39 0.52
40 0.53
41 0.52
42 0.51
43 0.47
44 0.43
45 0.38
46 0.3
47 0.28
48 0.28
49 0.31
50 0.29
51 0.31
52 0.29
53 0.27
54 0.27
55 0.26
56 0.23
57 0.18
58 0.17
59 0.19
60 0.24
61 0.25
62 0.31
63 0.38
64 0.39
65 0.4
66 0.41
67 0.39
68 0.37
69 0.41
70 0.37
71 0.35
72 0.4
73 0.47
74 0.44
75 0.43
76 0.38
77 0.31
78 0.28
79 0.24
80 0.2
81 0.12
82 0.12
83 0.11
84 0.11
85 0.11
86 0.1
87 0.09
88 0.06
89 0.07
90 0.07
91 0.06
92 0.07
93 0.07
94 0.08
95 0.08
96 0.11
97 0.11
98 0.12
99 0.14
100 0.22
101 0.26
102 0.27
103 0.32
104 0.32
105 0.34
106 0.37
107 0.35
108 0.27
109 0.27
110 0.26
111 0.24
112 0.28
113 0.24
114 0.24
115 0.22
116 0.21
117 0.18
118 0.19
119 0.16
120 0.09
121 0.09
122 0.07
123 0.08
124 0.09
125 0.09
126 0.09
127 0.09
128 0.09
129 0.09
130 0.08
131 0.1
132 0.09
133 0.09
134 0.08
135 0.1
136 0.12
137 0.13
138 0.16
139 0.16
140 0.18
141 0.2
142 0.2
143 0.2
144 0.23
145 0.25
146 0.27
147 0.27
148 0.26
149 0.27
150 0.27
151 0.27
152 0.23
153 0.25
154 0.27
155 0.35
156 0.43
157 0.48
158 0.55
159 0.58
160 0.62
161 0.63
162 0.62
163 0.56
164 0.53
165 0.51
166 0.47
167 0.44
168 0.38
169 0.32
170 0.25
171 0.21
172 0.15
173 0.1
174 0.07
175 0.06
176 0.07
177 0.09
178 0.11
179 0.12
180 0.18
181 0.19
182 0.28
183 0.37
184 0.44
185 0.49
186 0.57
187 0.6
188 0.64
189 0.69
190 0.67
191 0.64
192 0.58
193 0.53
194 0.45
195 0.41
196 0.35
197 0.29
198 0.23
199 0.18
200 0.16
201 0.14
202 0.16
203 0.15
204 0.11
205 0.1
206 0.09
207 0.09
208 0.1
209 0.13
210 0.12
211 0.13
212 0.15
213 0.21
214 0.22
215 0.24
216 0.26
217 0.26
218 0.33
219 0.38
220 0.45
221 0.42
222 0.42
223 0.41
224 0.42
225 0.39
226 0.33
227 0.28
228 0.2
229 0.18
230 0.2
231 0.2
232 0.15
233 0.13
234 0.13
235 0.14
236 0.13
237 0.11
238 0.09
239 0.08
240 0.08
241 0.08
242 0.07
243 0.06
244 0.06
245 0.07
246 0.09
247 0.1
248 0.13
249 0.14
250 0.13
251 0.14
252 0.14
253 0.17
254 0.17
255 0.17
256 0.17
257 0.22
258 0.25
259 0.27
260 0.32