Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6USW4

Protein Details
Accession A0A0L6USW4   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
45-67YAICIRRSEKDKKKIFKCDQCGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 3
Family & Domain DBs
Amino Acid Sequences MASNLFITLAWILVEKMNVPPPDGKFQDPEDMVEKIKRVFQNNGYAICIRRSEKDKKKIFKCDQCGVPFELQCQRHIAQVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.1
4 0.17
5 0.17
6 0.18
7 0.22
8 0.24
9 0.32
10 0.33
11 0.32
12 0.29
13 0.3
14 0.34
15 0.3
16 0.29
17 0.24
18 0.23
19 0.22
20 0.21
21 0.2
22 0.15
23 0.19
24 0.2
25 0.2
26 0.23
27 0.26
28 0.33
29 0.34
30 0.34
31 0.31
32 0.29
33 0.27
34 0.25
35 0.24
36 0.17
37 0.19
38 0.25
39 0.34
40 0.43
41 0.52
42 0.59
43 0.66
44 0.74
45 0.8
46 0.84
47 0.84
48 0.81
49 0.79
50 0.78
51 0.71
52 0.66
53 0.59
54 0.54
55 0.44
56 0.41
57 0.41
58 0.35
59 0.33
60 0.35
61 0.32
62 0.31