Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UM26

Protein Details
Accession A0A0L6UM26   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
47-79ILFIVPKTKTKEEKKKRTRKMTNETIKKKKNVTHydrophilic
NLS Segment(s)
PositionSequence
54-76TKTKEEKKKRTRKMTNETIKKKK
Subcellular Location(s) mito 12, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDRTTFYLLLPNLQFPSYLNLIVVNQTEMAWCALPFGDETFGIAVFILFIVPKTKTKEEKKKRTRKMTNETIKKKKNVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.17
3 0.21
4 0.17
5 0.16
6 0.13
7 0.13
8 0.13
9 0.14
10 0.14
11 0.1
12 0.08
13 0.08
14 0.08
15 0.08
16 0.08
17 0.07
18 0.06
19 0.06
20 0.05
21 0.06
22 0.06
23 0.06
24 0.06
25 0.05
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.04
32 0.03
33 0.03
34 0.03
35 0.02
36 0.03
37 0.05
38 0.07
39 0.11
40 0.16
41 0.22
42 0.32
43 0.43
44 0.54
45 0.63
46 0.73
47 0.81
48 0.87
49 0.91
50 0.94
51 0.94
52 0.93
53 0.92
54 0.92
55 0.92
56 0.92
57 0.92
58 0.91
59 0.89