Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6U9C6

Protein Details
Accession A0A0L6U9C6   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MNCLKSLINHLKKRQPKNTSKGKQRASNYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MNCLKSLINHLKKRQPKNTSKGKQRASNYQNINPKSQVTPKEAPNPFKSYREYASKRDECEHFEGKDQVARDGLTFEMLKFELQVKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.81
4 0.83
5 0.86
6 0.86
7 0.88
8 0.87
9 0.85
10 0.82
11 0.77
12 0.78
13 0.72
14 0.71
15 0.66
16 0.64
17 0.64
18 0.58
19 0.56
20 0.46
21 0.43
22 0.37
23 0.37
24 0.33
25 0.32
26 0.34
27 0.35
28 0.44
29 0.45
30 0.46
31 0.45
32 0.47
33 0.42
34 0.41
35 0.4
36 0.34
37 0.34
38 0.4
39 0.4
40 0.39
41 0.47
42 0.48
43 0.47
44 0.49
45 0.47
46 0.42
47 0.45
48 0.43
49 0.34
50 0.34
51 0.34
52 0.3
53 0.31
54 0.27
55 0.21
56 0.18
57 0.18
58 0.14
59 0.14
60 0.13
61 0.13
62 0.13
63 0.11
64 0.13
65 0.13
66 0.13
67 0.13
68 0.18