Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6VFK4

Protein Details
Accession A0A0L6VFK4    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-32TIEDTPKDNNQKKKGKPPNLCVKEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8.5, cyto 8, mito_nucl 8, mito 6.5, pero 2
Family & Domain DBs
Amino Acid Sequences MDLFIRTTIEDTPKDNNQKKKGKPPNLCVKEDQSLCMAWLNTSKDEVIGMNQTKGIFWDRIHNLYLEIMDEVIEKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.55
4 0.6
5 0.68
6 0.73
7 0.78
8 0.81
9 0.81
10 0.83
11 0.83
12 0.84
13 0.81
14 0.77
15 0.69
16 0.62
17 0.58
18 0.49
19 0.41
20 0.31
21 0.24
22 0.21
23 0.19
24 0.15
25 0.09
26 0.12
27 0.13
28 0.12
29 0.12
30 0.12
31 0.1
32 0.11
33 0.11
34 0.09
35 0.12
36 0.13
37 0.13
38 0.14
39 0.14
40 0.14
41 0.15
42 0.17
43 0.14
44 0.14
45 0.22
46 0.25
47 0.27
48 0.28
49 0.27
50 0.25
51 0.24
52 0.23
53 0.15
54 0.12
55 0.09
56 0.09