Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VTZ6

Protein Details
Accession A0A0L6VTZ6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-122GSKPDVKKASNGKRGRPRKNPVSTDDHydrophilic
NLS Segment(s)
PositionSequence
103-115KKASNGKRGRPRK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAPKRKDDESSKPASTNQNGDEETSSKKPKFVKEDPGMTAKQFEESAKAIAISVGEDGNIGTLYGWKGTTKMRIKVVVEGEEKEVVVQVGVNMTVSGSKPDVKKASNGKRGRPRKNPVSTDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.47
4 0.42
5 0.4
6 0.37
7 0.37
8 0.35
9 0.29
10 0.3
11 0.3
12 0.35
13 0.3
14 0.33
15 0.37
16 0.42
17 0.49
18 0.5
19 0.54
20 0.55
21 0.6
22 0.59
23 0.58
24 0.51
25 0.42
26 0.39
27 0.28
28 0.22
29 0.18
30 0.15
31 0.13
32 0.13
33 0.14
34 0.12
35 0.11
36 0.1
37 0.09
38 0.08
39 0.06
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.08
56 0.17
57 0.21
58 0.26
59 0.28
60 0.32
61 0.33
62 0.37
63 0.38
64 0.35
65 0.31
66 0.28
67 0.27
68 0.23
69 0.22
70 0.17
71 0.15
72 0.09
73 0.07
74 0.06
75 0.04
76 0.04
77 0.04
78 0.05
79 0.04
80 0.04
81 0.06
82 0.06
83 0.08
84 0.09
85 0.14
86 0.15
87 0.22
88 0.27
89 0.27
90 0.35
91 0.44
92 0.53
93 0.58
94 0.64
95 0.67
96 0.73
97 0.82
98 0.85
99 0.85
100 0.84
101 0.85
102 0.89