Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6U8P2

Protein Details
Accession A0A0L6U8P2   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSNKKPAIRRKFKKNKGNNSSEDDAHydrophilic
NLS Segment(s)
PositionSequence
4-16KKPAIRRKFKKNK
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MSNKKPAIRRKFKKNKGNNSSEDDAADKTAGHLKKEDYLVIIKWLKIKRNYRTGKAPPVGHPSKGKINGFEMCYDLVNPYGTCHRFPQLGDYIEPPHLYDGYQSPQSIPLKDQPNPPSDEGLIQYLQRQVQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.91
4 0.91
5 0.85
6 0.81
7 0.74
8 0.64
9 0.55
10 0.45
11 0.35
12 0.27
13 0.22
14 0.13
15 0.11
16 0.17
17 0.18
18 0.17
19 0.19
20 0.19
21 0.24
22 0.25
23 0.24
24 0.19
25 0.2
26 0.19
27 0.23
28 0.23
29 0.2
30 0.25
31 0.28
32 0.32
33 0.39
34 0.47
35 0.47
36 0.56
37 0.61
38 0.59
39 0.66
40 0.65
41 0.66
42 0.62
43 0.58
44 0.51
45 0.55
46 0.51
47 0.45
48 0.41
49 0.35
50 0.35
51 0.38
52 0.35
53 0.27
54 0.28
55 0.28
56 0.27
57 0.25
58 0.2
59 0.15
60 0.14
61 0.13
62 0.1
63 0.08
64 0.08
65 0.07
66 0.08
67 0.13
68 0.14
69 0.16
70 0.17
71 0.19
72 0.2
73 0.2
74 0.25
75 0.25
76 0.25
77 0.25
78 0.25
79 0.25
80 0.25
81 0.25
82 0.19
83 0.15
84 0.13
85 0.12
86 0.12
87 0.13
88 0.15
89 0.18
90 0.18
91 0.17
92 0.24
93 0.26
94 0.26
95 0.26
96 0.29
97 0.33
98 0.37
99 0.45
100 0.43
101 0.46
102 0.5
103 0.48
104 0.45
105 0.39
106 0.37
107 0.31
108 0.29
109 0.25
110 0.21
111 0.22
112 0.23