Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VSB4

Protein Details
Accession A0A0L6VSB4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
10-31KTSTSKKSTPIPKKAKLQPTNPHydrophilic
NLS Segment(s)
PositionSequence
22-22K
Subcellular Location(s) nucl 15, mito_nucl 14.166, mito 11, cyto_nucl 9.166
Family & Domain DBs
Amino Acid Sequences MPPKKKFNQKTSTSKKSTPIPKKAKLQPTNPTTGKPVIQRNSRKNGGNNSSEDDSADTTAGHLTKEDYLVIIEWLKIKWNYDRCFGTGEAPAVVCPAKGKIHGFEMMDINL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.74
3 0.73
4 0.75
5 0.74
6 0.74
7 0.74
8 0.75
9 0.8
10 0.82
11 0.84
12 0.81
13 0.79
14 0.77
15 0.73
16 0.74
17 0.65
18 0.58
19 0.51
20 0.46
21 0.41
22 0.37
23 0.4
24 0.39
25 0.47
26 0.54
27 0.57
28 0.63
29 0.64
30 0.63
31 0.59
32 0.6
33 0.57
34 0.51
35 0.46
36 0.42
37 0.38
38 0.34
39 0.29
40 0.21
41 0.16
42 0.12
43 0.11
44 0.07
45 0.05
46 0.07
47 0.06
48 0.06
49 0.05
50 0.06
51 0.06
52 0.07
53 0.07
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.11
63 0.12
64 0.14
65 0.21
66 0.29
67 0.31
68 0.36
69 0.38
70 0.35
71 0.38
72 0.36
73 0.32
74 0.26
75 0.25
76 0.19
77 0.17
78 0.16
79 0.14
80 0.14
81 0.11
82 0.09
83 0.11
84 0.13
85 0.17
86 0.2
87 0.21
88 0.25
89 0.3
90 0.3
91 0.3