Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VL03

Protein Details
Accession A0A0L6VL03    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MPKKAAPKPMKPTTKKPAIRRKSKKNRGNNSSEDDHydrophilic
NLS Segment(s)
PositionSequence
3-27KKAAPKPMKPTTKKPAIRRKSKKNR
Subcellular Location(s) nucl 21.5, mito_nucl 13.166, cyto_nucl 12.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MPKKAAPKPMKPTTKKPAIRRKSKKNRGNNSSEDDAADKTVVHLNKEDYLLLWKREGSCCCLSAKGEINGFEVMATNLRNQSPSNINLKPHQMNDLFHKYKDKYKKSTPNPYPAHVSPLSCNERVDAQADNETATSSPSEPAGNEIGSSDMESKNDYVCISTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.83
4 0.84
5 0.84
6 0.88
7 0.89
8 0.9
9 0.91
10 0.93
11 0.93
12 0.93
13 0.93
14 0.91
15 0.88
16 0.83
17 0.79
18 0.72
19 0.62
20 0.52
21 0.43
22 0.34
23 0.27
24 0.2
25 0.13
26 0.1
27 0.15
28 0.15
29 0.15
30 0.16
31 0.17
32 0.19
33 0.2
34 0.18
35 0.14
36 0.19
37 0.21
38 0.2
39 0.19
40 0.19
41 0.2
42 0.25
43 0.26
44 0.25
45 0.25
46 0.25
47 0.25
48 0.25
49 0.23
50 0.22
51 0.24
52 0.21
53 0.2
54 0.2
55 0.2
56 0.19
57 0.18
58 0.14
59 0.1
60 0.08
61 0.07
62 0.07
63 0.06
64 0.08
65 0.08
66 0.09
67 0.09
68 0.12
69 0.14
70 0.16
71 0.21
72 0.22
73 0.23
74 0.25
75 0.3
76 0.29
77 0.27
78 0.29
79 0.24
80 0.24
81 0.29
82 0.36
83 0.33
84 0.31
85 0.36
86 0.33
87 0.4
88 0.49
89 0.49
90 0.47
91 0.56
92 0.66
93 0.69
94 0.79
95 0.77
96 0.78
97 0.74
98 0.69
99 0.66
100 0.56
101 0.53
102 0.43
103 0.38
104 0.3
105 0.35
106 0.36
107 0.3
108 0.3
109 0.25
110 0.25
111 0.25
112 0.24
113 0.17
114 0.15
115 0.17
116 0.17
117 0.16
118 0.15
119 0.14
120 0.13
121 0.12
122 0.11
123 0.09
124 0.09
125 0.1
126 0.11
127 0.1
128 0.13
129 0.15
130 0.13
131 0.12
132 0.12
133 0.12
134 0.12
135 0.13
136 0.13
137 0.12
138 0.13
139 0.15
140 0.15
141 0.15
142 0.16
143 0.15
144 0.13