Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6UKM8

Protein Details
Accession A0A0L6UKM8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-54RSDVLKNWRRQQKKESHPLNRRQPPLRLHydrophilic
198-223LRTPLPPSKPPTRPNHRPKKTCGLYVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MSTDRQKKSSEILSTTLKLSFGQRTPRSDVLKNWRRQQKKESHPLNRRQPPLRLLTSPYLLHNPCNLRTCPTRRALFPILAARPLKRDHPRRPVSWSVYCSLLNMQALSSLLLCLSRCPPYGLPKCKNSFAILRWDDSEAKLYLNLMAEAVTFGLLPELKMKVHDFQLLLTTPFKYSTFKQRVASFDKNLLRRTLSELRTPLPPSKPPTRPNHRPKKTCGLYVHSVRIPLCTRCAVQVIRSSSHLASET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.38
4 0.3
5 0.25
6 0.25
7 0.27
8 0.27
9 0.35
10 0.39
11 0.44
12 0.5
13 0.56
14 0.58
15 0.55
16 0.59
17 0.6
18 0.65
19 0.67
20 0.7
21 0.72
22 0.74
23 0.77
24 0.79
25 0.79
26 0.79
27 0.83
28 0.83
29 0.84
30 0.86
31 0.9
32 0.9
33 0.88
34 0.86
35 0.8
36 0.76
37 0.71
38 0.68
39 0.63
40 0.54
41 0.5
42 0.46
43 0.44
44 0.39
45 0.35
46 0.35
47 0.31
48 0.3
49 0.31
50 0.31
51 0.31
52 0.35
53 0.34
54 0.32
55 0.39
56 0.44
57 0.45
58 0.48
59 0.47
60 0.44
61 0.5
62 0.49
63 0.42
64 0.4
65 0.39
66 0.33
67 0.34
68 0.34
69 0.27
70 0.27
71 0.27
72 0.32
73 0.35
74 0.44
75 0.48
76 0.58
77 0.63
78 0.63
79 0.68
80 0.68
81 0.65
82 0.61
83 0.54
84 0.44
85 0.41
86 0.38
87 0.31
88 0.24
89 0.19
90 0.14
91 0.11
92 0.1
93 0.08
94 0.08
95 0.07
96 0.06
97 0.04
98 0.04
99 0.05
100 0.05
101 0.06
102 0.07
103 0.09
104 0.1
105 0.12
106 0.14
107 0.23
108 0.32
109 0.4
110 0.42
111 0.47
112 0.5
113 0.49
114 0.49
115 0.42
116 0.37
117 0.3
118 0.35
119 0.29
120 0.27
121 0.26
122 0.27
123 0.25
124 0.22
125 0.23
126 0.13
127 0.12
128 0.11
129 0.1
130 0.09
131 0.09
132 0.09
133 0.06
134 0.05
135 0.05
136 0.05
137 0.05
138 0.04
139 0.03
140 0.03
141 0.04
142 0.04
143 0.04
144 0.06
145 0.07
146 0.07
147 0.09
148 0.11
149 0.13
150 0.15
151 0.17
152 0.16
153 0.15
154 0.18
155 0.17
156 0.17
157 0.16
158 0.15
159 0.13
160 0.14
161 0.15
162 0.15
163 0.17
164 0.26
165 0.32
166 0.36
167 0.4
168 0.43
169 0.48
170 0.53
171 0.57
172 0.49
173 0.5
174 0.51
175 0.51
176 0.5
177 0.46
178 0.39
179 0.34
180 0.39
181 0.4
182 0.36
183 0.38
184 0.38
185 0.38
186 0.41
187 0.43
188 0.41
189 0.38
190 0.41
191 0.42
192 0.49
193 0.56
194 0.59
195 0.67
196 0.71
197 0.77
198 0.82
199 0.87
200 0.87
201 0.86
202 0.85
203 0.86
204 0.81
205 0.79
206 0.74
207 0.7
208 0.68
209 0.67
210 0.66
211 0.56
212 0.53
213 0.45
214 0.45
215 0.41
216 0.35
217 0.33
218 0.3
219 0.29
220 0.29
221 0.35
222 0.31
223 0.32
224 0.37
225 0.38
226 0.37
227 0.38
228 0.39
229 0.34