Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VMW8

Protein Details
Accession A0A0L6VMW8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-70EYLHGYKWNNKNKKSCNSKSQKLSCTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 6.5, mito 3
Family & Domain DBs
Amino Acid Sequences FQSLTTEEEEWLDGQGNFIEKFLLLEIIKSLKKMNLGSDDVRLEEYLHGYKWNNKNKKSCNSKSQKLSCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.11
5 0.11
6 0.1
7 0.08
8 0.09
9 0.08
10 0.1
11 0.08
12 0.08
13 0.09
14 0.12
15 0.12
16 0.13
17 0.13
18 0.11
19 0.14
20 0.15
21 0.17
22 0.17
23 0.2
24 0.2
25 0.22
26 0.21
27 0.19
28 0.19
29 0.16
30 0.13
31 0.1
32 0.12
33 0.1
34 0.1
35 0.13
36 0.14
37 0.22
38 0.31
39 0.41
40 0.47
41 0.54
42 0.63
43 0.7
44 0.79
45 0.81
46 0.81
47 0.81
48 0.82
49 0.85
50 0.86