Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UD14

Protein Details
Accession A0A0L6UD14    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
167-187DSRFWRLRQRLAQRWTKKRAIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016651  PPM1  
IPR007213  Ppm1/Ppm2/Tcmp  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF04072  LCM  
Amino Acid Sequences MIVKMLAFACPRTIGVLFLLRPSVGMAVGRVTEQLTVTVSPQHLLLRGRKTSTTSNQSCPSATDPSREEERRSRTQTGPSETPTSTLPWPASLPSRNTTFKSFASEFAGLFVSASNRDPSASRRPPWVNMGTHHRTYVIDELVGRFNGATIGAESTKQVVSLGAGSDSRFWRLRQRLAQRWTKKRAIANHNQLASLCGPPLHLPALSLPPSASNSPSNTIIFIFIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.2
4 0.19
5 0.19
6 0.2
7 0.16
8 0.16
9 0.16
10 0.14
11 0.09
12 0.09
13 0.08
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.1
24 0.1
25 0.13
26 0.13
27 0.13
28 0.13
29 0.14
30 0.16
31 0.19
32 0.25
33 0.29
34 0.32
35 0.34
36 0.35
37 0.38
38 0.42
39 0.46
40 0.5
41 0.47
42 0.49
43 0.51
44 0.51
45 0.47
46 0.42
47 0.37
48 0.34
49 0.31
50 0.29
51 0.26
52 0.29
53 0.37
54 0.36
55 0.38
56 0.38
57 0.44
58 0.49
59 0.53
60 0.54
61 0.49
62 0.56
63 0.57
64 0.56
65 0.52
66 0.47
67 0.45
68 0.39
69 0.37
70 0.3
71 0.26
72 0.2
73 0.19
74 0.16
75 0.13
76 0.13
77 0.14
78 0.17
79 0.17
80 0.2
81 0.2
82 0.25
83 0.27
84 0.28
85 0.3
86 0.29
87 0.26
88 0.3
89 0.28
90 0.24
91 0.26
92 0.24
93 0.2
94 0.18
95 0.18
96 0.11
97 0.11
98 0.09
99 0.06
100 0.06
101 0.07
102 0.07
103 0.06
104 0.07
105 0.08
106 0.12
107 0.22
108 0.27
109 0.27
110 0.34
111 0.36
112 0.38
113 0.43
114 0.43
115 0.35
116 0.33
117 0.4
118 0.38
119 0.37
120 0.35
121 0.3
122 0.25
123 0.25
124 0.25
125 0.16
126 0.12
127 0.12
128 0.13
129 0.14
130 0.13
131 0.11
132 0.08
133 0.07
134 0.07
135 0.07
136 0.05
137 0.04
138 0.06
139 0.07
140 0.07
141 0.07
142 0.09
143 0.09
144 0.08
145 0.08
146 0.06
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.08
153 0.11
154 0.12
155 0.16
156 0.17
157 0.18
158 0.27
159 0.33
160 0.41
161 0.47
162 0.56
163 0.62
164 0.68
165 0.78
166 0.78
167 0.81
168 0.81
169 0.78
170 0.74
171 0.71
172 0.73
173 0.72
174 0.73
175 0.73
176 0.73
177 0.67
178 0.62
179 0.55
180 0.47
181 0.39
182 0.29
183 0.2
184 0.12
185 0.12
186 0.13
187 0.15
188 0.14
189 0.13
190 0.12
191 0.15
192 0.21
193 0.22
194 0.21
195 0.19
196 0.19
197 0.23
198 0.24
199 0.25
200 0.22
201 0.24
202 0.28
203 0.31
204 0.29
205 0.26
206 0.25