Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VH78

Protein Details
Accession A0A0L6VH78    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKKASHKPTKPTTKKPAIQRNSKRTDKEEHydrophilic
NLS Segment(s)
PositionSequence
6-17SHKPTKPTTKKP
Subcellular Location(s) nucl 18, mito_nucl 14.166, cyto_nucl 10.666, mito 8
Family & Domain DBs
Amino Acid Sequences MPKKASHKPTKPTTKKPAIQRNSKRTDKEEYLVMIEWLNIKHNCNSCFQTRKAPAVGYNYKQVNTKSISMGFGLTNEDQKVGISTTNDKIESMCPHYHARNNFMASQAFINPWFKVDAKSDNKTASSTSDNRSKTMRRELNWRIKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.87
4 0.87
5 0.85
6 0.86
7 0.86
8 0.86
9 0.85
10 0.86
11 0.8
12 0.74
13 0.73
14 0.67
15 0.59
16 0.52
17 0.44
18 0.39
19 0.34
20 0.3
21 0.21
22 0.16
23 0.16
24 0.12
25 0.16
26 0.15
27 0.16
28 0.21
29 0.26
30 0.28
31 0.3
32 0.33
33 0.35
34 0.39
35 0.39
36 0.43
37 0.42
38 0.44
39 0.41
40 0.39
41 0.35
42 0.37
43 0.41
44 0.33
45 0.36
46 0.33
47 0.32
48 0.34
49 0.31
50 0.27
51 0.24
52 0.24
53 0.19
54 0.19
55 0.19
56 0.16
57 0.16
58 0.12
59 0.1
60 0.11
61 0.09
62 0.1
63 0.09
64 0.09
65 0.08
66 0.08
67 0.08
68 0.07
69 0.07
70 0.07
71 0.1
72 0.13
73 0.15
74 0.15
75 0.14
76 0.15
77 0.16
78 0.18
79 0.2
80 0.18
81 0.2
82 0.23
83 0.26
84 0.31
85 0.31
86 0.33
87 0.33
88 0.35
89 0.33
90 0.31
91 0.28
92 0.24
93 0.23
94 0.19
95 0.15
96 0.14
97 0.15
98 0.13
99 0.14
100 0.15
101 0.14
102 0.16
103 0.19
104 0.27
105 0.32
106 0.36
107 0.39
108 0.39
109 0.4
110 0.38
111 0.36
112 0.3
113 0.3
114 0.3
115 0.32
116 0.38
117 0.38
118 0.39
119 0.45
120 0.47
121 0.47
122 0.54
123 0.57
124 0.52
125 0.61
126 0.69