Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6UQU0

Protein Details
Accession A0A0L6UQU0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-34ITGFVEKKKSRKSKQSYYNSLHPNHydrophilic
NLS Segment(s)
PositionSequence
77-82QRRRPK
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MSRKEKKFQQITGFVEKKKSRKSKQSYYNSLHPNFLFIYLPSPAYLKPKGNPNKPRTTTRDPTAFEIMEKIRREENQRRRPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.61
4 0.59
5 0.61
6 0.66
7 0.64
8 0.7
9 0.78
10 0.79
11 0.84
12 0.86
13 0.85
14 0.81
15 0.8
16 0.77
17 0.69
18 0.61
19 0.5
20 0.42
21 0.33
22 0.28
23 0.19
24 0.12
25 0.12
26 0.1
27 0.1
28 0.09
29 0.09
30 0.09
31 0.13
32 0.16
33 0.16
34 0.19
35 0.28
36 0.37
37 0.46
38 0.55
39 0.58
40 0.66
41 0.69
42 0.74
43 0.72
44 0.73
45 0.7
46 0.66
47 0.67
48 0.59
49 0.59
50 0.56
51 0.47
52 0.39
53 0.36
54 0.33
55 0.32
56 0.32
57 0.29
58 0.29
59 0.34
60 0.43
61 0.49
62 0.57