Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6ULK0

Protein Details
Accession A0A0L6ULK0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-105DWPKLKAKIQEKWGRQRRRFREGDLBasic
NLS Segment(s)
PositionSequence
94-98GRQRR
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MRYPFSHCPFNHCSEAKIRPRDYPGVRFSVEAVDQFLNRYEEAVEVEGVNGGDMVRQIRNFIPNEEDLRDGEEMDGYEEQDWPKLKAKIQEKWGRQRRRFREGDLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.53
3 0.54
4 0.57
5 0.54
6 0.51
7 0.55
8 0.61
9 0.6
10 0.58
11 0.53
12 0.48
13 0.47
14 0.42
15 0.37
16 0.31
17 0.26
18 0.19
19 0.18
20 0.14
21 0.13
22 0.13
23 0.14
24 0.12
25 0.12
26 0.12
27 0.09
28 0.09
29 0.1
30 0.1
31 0.08
32 0.06
33 0.07
34 0.07
35 0.06
36 0.05
37 0.04
38 0.03
39 0.03
40 0.04
41 0.05
42 0.06
43 0.06
44 0.07
45 0.09
46 0.13
47 0.14
48 0.15
49 0.17
50 0.18
51 0.21
52 0.2
53 0.2
54 0.16
55 0.18
56 0.17
57 0.14
58 0.12
59 0.1
60 0.08
61 0.09
62 0.1
63 0.08
64 0.08
65 0.09
66 0.1
67 0.13
68 0.14
69 0.15
70 0.22
71 0.25
72 0.28
73 0.35
74 0.43
75 0.47
76 0.56
77 0.63
78 0.65
79 0.73
80 0.8
81 0.82
82 0.83
83 0.87
84 0.85
85 0.86
86 0.82