Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6U7X4

Protein Details
Accession A0A0L6U7X4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
128-155LSSALKKKLFHQDKKSRRRHISELPIAFHydrophilic
NLS Segment(s)
PositionSequence
141-145KKSRR
Subcellular Location(s) nucl 11, cyto 6, mito 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MDLLTKSKGELGLQYVQTLNWHCLHPWEFHLIQIALGTDSIGKAFILTDNKGVLQRLSDPKAEKTGQYLFLEICDAWRNLPGDIDIHLVWCPGHQGIVGREAANLLANEAARRNDHPDRRLWANVNKLSSALKKKLFHQDKKSRRRHISELPIAFSAVIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.23
4 0.25
5 0.25
6 0.23
7 0.19
8 0.19
9 0.18
10 0.23
11 0.26
12 0.24
13 0.25
14 0.28
15 0.26
16 0.26
17 0.3
18 0.24
19 0.22
20 0.2
21 0.17
22 0.11
23 0.1
24 0.1
25 0.05
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.05
32 0.08
33 0.11
34 0.12
35 0.13
36 0.13
37 0.14
38 0.15
39 0.16
40 0.13
41 0.1
42 0.16
43 0.2
44 0.22
45 0.25
46 0.26
47 0.27
48 0.32
49 0.32
50 0.26
51 0.24
52 0.25
53 0.25
54 0.24
55 0.23
56 0.17
57 0.17
58 0.17
59 0.13
60 0.11
61 0.09
62 0.08
63 0.08
64 0.1
65 0.11
66 0.1
67 0.1
68 0.1
69 0.08
70 0.09
71 0.11
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.05
80 0.05
81 0.05
82 0.07
83 0.08
84 0.11
85 0.12
86 0.11
87 0.11
88 0.11
89 0.11
90 0.1
91 0.09
92 0.06
93 0.07
94 0.07
95 0.07
96 0.09
97 0.1
98 0.1
99 0.12
100 0.19
101 0.26
102 0.33
103 0.35
104 0.39
105 0.43
106 0.46
107 0.5
108 0.48
109 0.46
110 0.49
111 0.5
112 0.47
113 0.42
114 0.38
115 0.37
116 0.39
117 0.4
118 0.38
119 0.41
120 0.42
121 0.48
122 0.58
123 0.65
124 0.67
125 0.7
126 0.75
127 0.78
128 0.87
129 0.91
130 0.9
131 0.89
132 0.88
133 0.85
134 0.85
135 0.85
136 0.83
137 0.77
138 0.7
139 0.61
140 0.54