Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UTW7

Protein Details
Accession A0A0L6UTW7    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-105AQMAKRPTRHPCQLRGKNPNPKNSKTRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 12, nucl 4.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MRTSTNWTSPRFSVPPSAPRVAFTRLPRWEPWNDKRVPSGRFVELFRMSLADFMWLSDEFRENLAQEPLDRGQPLTVEAQMAKRPTRHPCQLRGKNPNPKNSKTRISN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.47
4 0.49
5 0.42
6 0.42
7 0.43
8 0.4
9 0.4
10 0.37
11 0.4
12 0.41
13 0.44
14 0.45
15 0.46
16 0.49
17 0.53
18 0.55
19 0.55
20 0.52
21 0.5
22 0.54
23 0.55
24 0.49
25 0.44
26 0.41
27 0.35
28 0.35
29 0.34
30 0.32
31 0.27
32 0.26
33 0.21
34 0.18
35 0.15
36 0.13
37 0.12
38 0.08
39 0.06
40 0.06
41 0.07
42 0.06
43 0.07
44 0.07
45 0.08
46 0.07
47 0.08
48 0.09
49 0.08
50 0.09
51 0.1
52 0.1
53 0.09
54 0.12
55 0.12
56 0.13
57 0.13
58 0.11
59 0.11
60 0.11
61 0.12
62 0.11
63 0.1
64 0.1
65 0.11
66 0.13
67 0.16
68 0.19
69 0.2
70 0.22
71 0.28
72 0.35
73 0.43
74 0.5
75 0.54
76 0.61
77 0.7
78 0.76
79 0.81
80 0.84
81 0.85
82 0.86
83 0.86
84 0.86
85 0.83
86 0.8
87 0.79
88 0.76