Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0NB65

Protein Details
Accession A0A0L0NB65    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGNGAKAQQKRERNQKDKNTAKSQLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR007513  SERF-like_N  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF04419  4F5  
PF12907  zf-met2  
Amino Acid Sequences MGNGAKAQQKRERNQKDKNTAKSQLKVNEQAKNIQCAVCKATFLQTTRAAELTEHAANKHNKTLAECFPGIEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.88
4 0.88
5 0.87
6 0.84
7 0.82
8 0.79
9 0.73
10 0.7
11 0.65
12 0.62
13 0.62
14 0.58
15 0.55
16 0.5
17 0.52
18 0.46
19 0.43
20 0.38
21 0.3
22 0.26
23 0.21
24 0.23
25 0.16
26 0.15
27 0.12
28 0.15
29 0.18
30 0.19
31 0.22
32 0.23
33 0.25
34 0.26
35 0.26
36 0.22
37 0.18
38 0.18
39 0.18
40 0.16
41 0.15
42 0.15
43 0.22
44 0.26
45 0.29
46 0.33
47 0.32
48 0.3
49 0.35
50 0.4
51 0.39
52 0.41
53 0.38