Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0N973

Protein Details
Accession A0A0L0N973   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
141-168SKKPEASADKKVKKKAKKIKLSFDEDEGBasic
NLS Segment(s)
PositionSequence
105-118EAKSAIGGRKRKVG
140-160DSKKPEASADKKVKKKAKKIK
Subcellular Location(s) mito 14, mito_nucl 12.333, nucl 9.5, cyto_mito 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSQKVTSKNLAYSSSLPPFLAALRAQASGASGPDPLAAAQRRSAKKRSSSEEAEDAPLVVDEHGNTVTVEVDKDGTVKETAAKAEDEAGPQDANSEDKSQKREGEAKSAIGGRKRKVGRVIGDAADETVHKDAPHSNIKDSKKPEASADKKVKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.3
4 0.27
5 0.25
6 0.22
7 0.21
8 0.15
9 0.13
10 0.14
11 0.14
12 0.14
13 0.13
14 0.14
15 0.11
16 0.12
17 0.09
18 0.08
19 0.07
20 0.08
21 0.08
22 0.07
23 0.12
24 0.14
25 0.15
26 0.2
27 0.28
28 0.35
29 0.4
30 0.46
31 0.47
32 0.54
33 0.6
34 0.63
35 0.62
36 0.6
37 0.59
38 0.57
39 0.51
40 0.44
41 0.36
42 0.29
43 0.21
44 0.17
45 0.12
46 0.07
47 0.06
48 0.04
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.06
59 0.05
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.08
67 0.09
68 0.09
69 0.09
70 0.08
71 0.1
72 0.1
73 0.09
74 0.08
75 0.09
76 0.08
77 0.07
78 0.08
79 0.06
80 0.07
81 0.08
82 0.11
83 0.13
84 0.16
85 0.2
86 0.22
87 0.23
88 0.26
89 0.32
90 0.3
91 0.35
92 0.34
93 0.31
94 0.3
95 0.32
96 0.31
97 0.3
98 0.34
99 0.27
100 0.34
101 0.36
102 0.38
103 0.41
104 0.45
105 0.43
106 0.44
107 0.46
108 0.38
109 0.37
110 0.33
111 0.26
112 0.2
113 0.16
114 0.12
115 0.09
116 0.09
117 0.08
118 0.09
119 0.13
120 0.18
121 0.27
122 0.28
123 0.32
124 0.4
125 0.45
126 0.52
127 0.54
128 0.57
129 0.54
130 0.53
131 0.55
132 0.58
133 0.58
134 0.61
135 0.67
136 0.67
137 0.69
138 0.77
139 0.79
140 0.78
141 0.84
142 0.84
143 0.84
144 0.86
145 0.88
146 0.9
147 0.9
148 0.88