Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0N6R1

Protein Details
Accession A0A0L0N6R1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
316-337LLSMHQAKKLQKEERRKEKSRSHydrophilic
NLS Segment(s)
PositionSequence
324-337KLQKEERRKEKSRS
Subcellular Location(s) mito 22, cyto 3.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR023179  GTP-bd_ortho_bundle_sf  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
Amino Acid Sequences MARFLPRDSFGIPSSIPKTYFLGHHAAGANKIKGLLSTISLVLECRDFRLPLSTHNPTLERTVAGRERLVVYTKSDLGTDSRGARQTLRRLYGDRVVFWDKNRPATTEALLTRLKDTARAQDSLTGLRALVVGMPNVGKSTLLNALRSAGSPGKKAKAAKTGDQAGVTRKVGTSVRVAESEEKGGVAGGVFVLDTPGIFQPYVDDGETMIKVALAHGIKKGLIPDEVLADYLLFRMNRWDPRLYARYCEPTNDVNDFLTAVAARDGKLKTGGLPNWQEAAARILSQWRDGRLGRYVLDELHEEDIRAHELLLQEPLLSMHQAKKLQKEERRKEKSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.29
4 0.27
5 0.29
6 0.28
7 0.3
8 0.27
9 0.29
10 0.25
11 0.29
12 0.3
13 0.29
14 0.32
15 0.35
16 0.32
17 0.27
18 0.27
19 0.23
20 0.2
21 0.21
22 0.17
23 0.13
24 0.14
25 0.14
26 0.14
27 0.14
28 0.14
29 0.12
30 0.14
31 0.12
32 0.14
33 0.16
34 0.16
35 0.16
36 0.23
37 0.23
38 0.28
39 0.36
40 0.38
41 0.38
42 0.41
43 0.41
44 0.35
45 0.38
46 0.32
47 0.25
48 0.22
49 0.26
50 0.27
51 0.27
52 0.26
53 0.24
54 0.25
55 0.26
56 0.28
57 0.22
58 0.21
59 0.23
60 0.24
61 0.22
62 0.2
63 0.19
64 0.17
65 0.19
66 0.19
67 0.18
68 0.21
69 0.23
70 0.24
71 0.27
72 0.32
73 0.37
74 0.41
75 0.43
76 0.42
77 0.42
78 0.45
79 0.48
80 0.43
81 0.35
82 0.34
83 0.35
84 0.34
85 0.33
86 0.39
87 0.34
88 0.4
89 0.4
90 0.37
91 0.34
92 0.34
93 0.34
94 0.3
95 0.28
96 0.25
97 0.25
98 0.24
99 0.22
100 0.21
101 0.2
102 0.18
103 0.19
104 0.23
105 0.25
106 0.26
107 0.25
108 0.27
109 0.28
110 0.25
111 0.24
112 0.16
113 0.13
114 0.12
115 0.12
116 0.07
117 0.07
118 0.06
119 0.05
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.05
126 0.04
127 0.06
128 0.12
129 0.13
130 0.13
131 0.13
132 0.15
133 0.15
134 0.15
135 0.16
136 0.14
137 0.14
138 0.16
139 0.19
140 0.2
141 0.23
142 0.25
143 0.26
144 0.31
145 0.33
146 0.34
147 0.37
148 0.38
149 0.35
150 0.34
151 0.31
152 0.26
153 0.26
154 0.22
155 0.17
156 0.13
157 0.14
158 0.14
159 0.14
160 0.14
161 0.13
162 0.15
163 0.15
164 0.16
165 0.16
166 0.16
167 0.16
168 0.13
169 0.1
170 0.09
171 0.08
172 0.07
173 0.05
174 0.04
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.04
183 0.04
184 0.05
185 0.05
186 0.05
187 0.06
188 0.08
189 0.1
190 0.09
191 0.08
192 0.08
193 0.1
194 0.1
195 0.09
196 0.07
197 0.06
198 0.06
199 0.06
200 0.1
201 0.09
202 0.1
203 0.1
204 0.11
205 0.11
206 0.12
207 0.13
208 0.1
209 0.1
210 0.1
211 0.1
212 0.11
213 0.11
214 0.11
215 0.09
216 0.08
217 0.07
218 0.07
219 0.09
220 0.07
221 0.07
222 0.12
223 0.17
224 0.23
225 0.27
226 0.29
227 0.28
228 0.36
229 0.44
230 0.4
231 0.39
232 0.39
233 0.42
234 0.4
235 0.41
236 0.37
237 0.33
238 0.36
239 0.34
240 0.3
241 0.23
242 0.22
243 0.2
244 0.16
245 0.13
246 0.09
247 0.07
248 0.08
249 0.08
250 0.08
251 0.13
252 0.14
253 0.14
254 0.16
255 0.16
256 0.18
257 0.25
258 0.27
259 0.29
260 0.33
261 0.33
262 0.33
263 0.33
264 0.29
265 0.22
266 0.24
267 0.17
268 0.14
269 0.12
270 0.16
271 0.17
272 0.23
273 0.25
274 0.23
275 0.28
276 0.29
277 0.32
278 0.32
279 0.34
280 0.29
281 0.3
282 0.29
283 0.24
284 0.25
285 0.23
286 0.19
287 0.21
288 0.21
289 0.17
290 0.17
291 0.18
292 0.18
293 0.17
294 0.14
295 0.12
296 0.13
297 0.15
298 0.16
299 0.14
300 0.12
301 0.12
302 0.13
303 0.12
304 0.12
305 0.14
306 0.17
307 0.23
308 0.31
309 0.35
310 0.44
311 0.52
312 0.6
313 0.67
314 0.73
315 0.78
316 0.82
317 0.87