Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0N2U2

Protein Details
Accession A0A0L0N2U2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
211-251SSNWWRCSKCLKRIHINRNGYSCPNCKSSCQVKRKEVRLKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQNMEFAYTPCHYDNSMTYPFSIYDDGSSSXQHYQSEPLSRYGSSEGSTQGSSTFASPILSHKYYTFHEPASSGASPHTQHAQRSPSSTTVYYGSPDLDAEQDMAQPRGSSDERHVKFSQSGRDYPFCCLYPGCTAKPFRRRADLDRHYKHRHAPESQKESFNCDYPRCARRLDPFHRLDHFRDHLREFHKEDIEKRGGTINEEWLGDRQVSSNWWRCSKCLKRIHINRNGYSCPNCKSSCQVKRKEVRLKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.29
4 0.26
5 0.26
6 0.26
7 0.25
8 0.25
9 0.23
10 0.17
11 0.14
12 0.16
13 0.17
14 0.17
15 0.2
16 0.2
17 0.19
18 0.21
19 0.2
20 0.19
21 0.21
22 0.28
23 0.26
24 0.28
25 0.29
26 0.26
27 0.28
28 0.29
29 0.27
30 0.2
31 0.19
32 0.17
33 0.18
34 0.18
35 0.16
36 0.14
37 0.13
38 0.12
39 0.11
40 0.1
41 0.08
42 0.09
43 0.09
44 0.12
45 0.18
46 0.19
47 0.19
48 0.19
49 0.22
50 0.24
51 0.3
52 0.28
53 0.22
54 0.22
55 0.22
56 0.22
57 0.24
58 0.22
59 0.16
60 0.15
61 0.17
62 0.16
63 0.18
64 0.23
65 0.2
66 0.22
67 0.27
68 0.31
69 0.29
70 0.32
71 0.32
72 0.28
73 0.29
74 0.28
75 0.24
76 0.21
77 0.2
78 0.18
79 0.16
80 0.13
81 0.1
82 0.1
83 0.09
84 0.08
85 0.07
86 0.07
87 0.07
88 0.08
89 0.09
90 0.09
91 0.09
92 0.08
93 0.08
94 0.12
95 0.12
96 0.12
97 0.17
98 0.26
99 0.27
100 0.33
101 0.33
102 0.3
103 0.34
104 0.36
105 0.38
106 0.31
107 0.33
108 0.31
109 0.34
110 0.33
111 0.32
112 0.31
113 0.24
114 0.21
115 0.18
116 0.16
117 0.19
118 0.21
119 0.2
120 0.22
121 0.26
122 0.32
123 0.41
124 0.47
125 0.43
126 0.48
127 0.51
128 0.52
129 0.6
130 0.61
131 0.63
132 0.63
133 0.68
134 0.66
135 0.64
136 0.65
137 0.62
138 0.59
139 0.55
140 0.58
141 0.6
142 0.63
143 0.63
144 0.62
145 0.54
146 0.55
147 0.49
148 0.44
149 0.38
150 0.31
151 0.32
152 0.34
153 0.38
154 0.33
155 0.34
156 0.34
157 0.39
158 0.48
159 0.5
160 0.52
161 0.52
162 0.55
163 0.58
164 0.57
165 0.51
166 0.49
167 0.47
168 0.43
169 0.43
170 0.41
171 0.42
172 0.42
173 0.45
174 0.41
175 0.43
176 0.43
177 0.42
178 0.43
179 0.45
180 0.45
181 0.39
182 0.36
183 0.36
184 0.3
185 0.31
186 0.3
187 0.26
188 0.23
189 0.24
190 0.24
191 0.2
192 0.21
193 0.17
194 0.16
195 0.12
196 0.11
197 0.15
198 0.21
199 0.29
200 0.33
201 0.4
202 0.41
203 0.43
204 0.53
205 0.59
206 0.62
207 0.62
208 0.66
209 0.69
210 0.79
211 0.87
212 0.86
213 0.85
214 0.82
215 0.79
216 0.74
217 0.69
218 0.65
219 0.6
220 0.54
221 0.52
222 0.47
223 0.44
224 0.48
225 0.53
226 0.57
227 0.62
228 0.67
229 0.71
230 0.79
231 0.86