Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NAY0

Protein Details
Accession A0A0L0NAY0   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
150-173TILRLAKERFRKRTRTRPVQASIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019622  Rrn9_dom  
Pfam View protein in Pfam  
PF10680  RRN9  
Amino Acid Sequences MERNAPTTDWDLDSDEIASVTSEDLHSNRPNRWTGPKSSWRLLTQEERLLWRSVRQLEDQDLAAHLYDAFALRRAGGSAETARGLTVKMEDGQDAIWAPPKLWTSWPLKERHMPQEGLIKKQDDEDEKFTFRMEEKKIPSSELQGELGATILRLAKERFRKRTRTRPVQASIESAAAAESSLPSSPPVSGSAESGEDSGRMQIDSDVTSPHGGRPKAYEPQTYEPQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.16
3 0.13
4 0.11
5 0.1
6 0.07
7 0.07
8 0.07
9 0.07
10 0.09
11 0.1
12 0.16
13 0.22
14 0.26
15 0.29
16 0.34
17 0.37
18 0.4
19 0.48
20 0.48
21 0.49
22 0.55
23 0.61
24 0.63
25 0.64
26 0.65
27 0.58
28 0.56
29 0.54
30 0.52
31 0.47
32 0.45
33 0.42
34 0.4
35 0.4
36 0.39
37 0.34
38 0.29
39 0.31
40 0.3
41 0.31
42 0.3
43 0.31
44 0.31
45 0.33
46 0.3
47 0.24
48 0.2
49 0.17
50 0.14
51 0.11
52 0.08
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.07
64 0.09
65 0.09
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.07
73 0.06
74 0.06
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.1
84 0.09
85 0.09
86 0.12
87 0.13
88 0.14
89 0.15
90 0.19
91 0.21
92 0.27
93 0.32
94 0.32
95 0.34
96 0.39
97 0.42
98 0.44
99 0.42
100 0.36
101 0.32
102 0.38
103 0.36
104 0.34
105 0.32
106 0.26
107 0.22
108 0.24
109 0.25
110 0.21
111 0.23
112 0.25
113 0.25
114 0.26
115 0.25
116 0.24
117 0.22
118 0.19
119 0.22
120 0.21
121 0.25
122 0.28
123 0.33
124 0.34
125 0.35
126 0.35
127 0.32
128 0.31
129 0.26
130 0.23
131 0.17
132 0.17
133 0.14
134 0.14
135 0.09
136 0.06
137 0.05
138 0.05
139 0.06
140 0.08
141 0.09
142 0.16
143 0.26
144 0.35
145 0.45
146 0.52
147 0.62
148 0.7
149 0.8
150 0.84
151 0.85
152 0.84
153 0.83
154 0.82
155 0.78
156 0.7
157 0.62
158 0.52
159 0.42
160 0.33
161 0.24
162 0.18
163 0.11
164 0.09
165 0.06
166 0.04
167 0.05
168 0.05
169 0.06
170 0.07
171 0.08
172 0.08
173 0.09
174 0.11
175 0.13
176 0.14
177 0.14
178 0.15
179 0.16
180 0.16
181 0.15
182 0.13
183 0.1
184 0.1
185 0.11
186 0.1
187 0.09
188 0.09
189 0.09
190 0.11
191 0.12
192 0.12
193 0.12
194 0.13
195 0.16
196 0.16
197 0.19
198 0.26
199 0.24
200 0.26
201 0.31
202 0.36
203 0.43
204 0.47
205 0.49
206 0.49
207 0.56