Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NH61

Protein Details
Accession A0A0L0NH61    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
124-143NKDQNKDKNKDQNKDKNKNNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, golg 2
Family & Domain DBs
Amino Acid Sequences MKSVAFLLFTAGLVSAVAVPVQLAERDNTKLQPLPVDVRRSEWYVRDAPPPQATAAAPPADDSQANKPPQGDAKPPQDDANKPPQGGANKDLNGQNNQNNQTNPANQNKDQNKDQNKDQNKDQNKDQNKDKNKDQNKDKNKNNGHLSLTPNIQAFLNQMGLGKVVNINAINSLSFPDQIVVVSQMQQLQTLQQLNIIGQQQIIGVLGQGVSNNGVKITILSRRDEESSTDXED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.05
3 0.05
4 0.05
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.08
11 0.09
12 0.12
13 0.16
14 0.19
15 0.2
16 0.22
17 0.25
18 0.25
19 0.27
20 0.28
21 0.32
22 0.35
23 0.4
24 0.37
25 0.38
26 0.4
27 0.4
28 0.39
29 0.35
30 0.34
31 0.33
32 0.35
33 0.38
34 0.38
35 0.39
36 0.39
37 0.37
38 0.32
39 0.29
40 0.26
41 0.22
42 0.22
43 0.18
44 0.15
45 0.15
46 0.16
47 0.15
48 0.15
49 0.15
50 0.18
51 0.25
52 0.26
53 0.26
54 0.25
55 0.26
56 0.31
57 0.33
58 0.33
59 0.32
60 0.4
61 0.41
62 0.42
63 0.44
64 0.43
65 0.42
66 0.41
67 0.45
68 0.39
69 0.36
70 0.35
71 0.35
72 0.34
73 0.34
74 0.32
75 0.28
76 0.26
77 0.29
78 0.31
79 0.29
80 0.29
81 0.29
82 0.31
83 0.31
84 0.33
85 0.34
86 0.31
87 0.33
88 0.32
89 0.33
90 0.32
91 0.33
92 0.35
93 0.33
94 0.42
95 0.42
96 0.45
97 0.45
98 0.49
99 0.49
100 0.48
101 0.52
102 0.52
103 0.54
104 0.53
105 0.53
106 0.54
107 0.53
108 0.53
109 0.53
110 0.53
111 0.53
112 0.55
113 0.58
114 0.58
115 0.6
116 0.62
117 0.64
118 0.65
119 0.66
120 0.7
121 0.72
122 0.73
123 0.76
124 0.8
125 0.8
126 0.8
127 0.77
128 0.76
129 0.7
130 0.64
131 0.58
132 0.52
133 0.49
134 0.41
135 0.37
136 0.31
137 0.27
138 0.23
139 0.18
140 0.14
141 0.12
142 0.1
143 0.1
144 0.08
145 0.08
146 0.08
147 0.08
148 0.08
149 0.07
150 0.06
151 0.06
152 0.08
153 0.07
154 0.07
155 0.08
156 0.09
157 0.08
158 0.08
159 0.1
160 0.09
161 0.09
162 0.09
163 0.08
164 0.08
165 0.08
166 0.09
167 0.09
168 0.09
169 0.1
170 0.11
171 0.13
172 0.13
173 0.14
174 0.13
175 0.12
176 0.16
177 0.17
178 0.15
179 0.15
180 0.16
181 0.15
182 0.19
183 0.19
184 0.15
185 0.12
186 0.13
187 0.11
188 0.1
189 0.11
190 0.06
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.06
197 0.07
198 0.09
199 0.09
200 0.08
201 0.09
202 0.08
203 0.1
204 0.13
205 0.19
206 0.21
207 0.24
208 0.27
209 0.3
210 0.33
211 0.33
212 0.33