Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NLP9

Protein Details
Accession A0A0L0NLP9   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
297-321SGRKRGAPGSTKPKRRRPEYDSDDDBasic
360-383LDDEDSGRRRSKKQKTTEPEEDEDAcidic
NLS Segment(s)
PositionSequence
264-266RRR
292-313GRGLGSGRKRGAPGSTKPKRRR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007149  Leo1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0016570  P:histone modification  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF04004  Leo1  
Amino Acid Sequences MSDSEDPLDVVDEGGEDLFGDDGEDEAASPPARVLDDDELASDPDEDADARNRDYDDDMPQENRDRVVAELTTYRHRIPKPRDSMLRIMRVPKFIKLMPEVYAPDTFEPTEFDVANAKAEQPRHVARVRRDSSTGELKSNTNIYRWSDGSVTISVGGEHYEIQKKLLATGPNQPYNELHDGHYYAAAAELGCNMLMTVGHLKEQYNVRPNKAVGDDALSLFAERMAQASKAYKGEEMIVRTTRDPELQKKQDEMAEKERMKAQRRRENAALKMDGGLGRAGRGGLSIGDLEGRGLGSGRKRGAPGSTKPKRRRPEYDSDDDLPQGVGRHEDYDMDDGFLVGSDEEEMESGADEYEEEEELDDEDSGRRRSKKQKTTEPEEDEDAEGDNVDAEPSSRARRRNVVDDDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.04
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.09
15 0.09
16 0.09
17 0.09
18 0.1
19 0.11
20 0.11
21 0.15
22 0.17
23 0.19
24 0.19
25 0.2
26 0.19
27 0.19
28 0.19
29 0.14
30 0.1
31 0.08
32 0.09
33 0.08
34 0.09
35 0.16
36 0.18
37 0.18
38 0.2
39 0.2
40 0.21
41 0.25
42 0.25
43 0.24
44 0.26
45 0.29
46 0.28
47 0.31
48 0.35
49 0.33
50 0.31
51 0.26
52 0.22
53 0.2
54 0.22
55 0.19
56 0.15
57 0.18
58 0.2
59 0.25
60 0.27
61 0.28
62 0.32
63 0.36
64 0.44
65 0.49
66 0.57
67 0.59
68 0.65
69 0.71
70 0.69
71 0.75
72 0.72
73 0.71
74 0.64
75 0.63
76 0.57
77 0.57
78 0.53
79 0.47
80 0.43
81 0.37
82 0.39
83 0.35
84 0.34
85 0.29
86 0.3
87 0.28
88 0.27
89 0.26
90 0.22
91 0.19
92 0.19
93 0.17
94 0.14
95 0.14
96 0.14
97 0.15
98 0.13
99 0.13
100 0.15
101 0.15
102 0.16
103 0.14
104 0.14
105 0.15
106 0.17
107 0.19
108 0.2
109 0.23
110 0.27
111 0.32
112 0.37
113 0.4
114 0.5
115 0.51
116 0.48
117 0.48
118 0.45
119 0.45
120 0.47
121 0.42
122 0.33
123 0.32
124 0.3
125 0.3
126 0.32
127 0.28
128 0.2
129 0.21
130 0.22
131 0.23
132 0.23
133 0.23
134 0.19
135 0.18
136 0.19
137 0.17
138 0.14
139 0.11
140 0.1
141 0.09
142 0.08
143 0.08
144 0.06
145 0.06
146 0.09
147 0.13
148 0.13
149 0.14
150 0.16
151 0.15
152 0.17
153 0.2
154 0.19
155 0.17
156 0.26
157 0.31
158 0.34
159 0.34
160 0.33
161 0.3
162 0.33
163 0.33
164 0.26
165 0.21
166 0.18
167 0.18
168 0.18
169 0.17
170 0.12
171 0.09
172 0.08
173 0.07
174 0.05
175 0.04
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.04
184 0.06
185 0.06
186 0.07
187 0.08
188 0.08
189 0.12
190 0.15
191 0.18
192 0.25
193 0.27
194 0.27
195 0.3
196 0.29
197 0.29
198 0.27
199 0.23
200 0.15
201 0.16
202 0.15
203 0.12
204 0.13
205 0.1
206 0.09
207 0.08
208 0.08
209 0.05
210 0.04
211 0.05
212 0.05
213 0.05
214 0.07
215 0.08
216 0.11
217 0.12
218 0.12
219 0.12
220 0.12
221 0.14
222 0.16
223 0.16
224 0.17
225 0.18
226 0.19
227 0.19
228 0.21
229 0.19
230 0.21
231 0.23
232 0.28
233 0.36
234 0.4
235 0.42
236 0.41
237 0.42
238 0.42
239 0.43
240 0.4
241 0.37
242 0.4
243 0.39
244 0.39
245 0.42
246 0.45
247 0.48
248 0.5
249 0.53
250 0.53
251 0.57
252 0.63
253 0.65
254 0.66
255 0.64
256 0.64
257 0.55
258 0.46
259 0.42
260 0.36
261 0.29
262 0.22
263 0.17
264 0.1
265 0.09
266 0.09
267 0.08
268 0.06
269 0.06
270 0.06
271 0.05
272 0.05
273 0.05
274 0.05
275 0.05
276 0.05
277 0.05
278 0.05
279 0.05
280 0.04
281 0.05
282 0.07
283 0.11
284 0.16
285 0.18
286 0.2
287 0.21
288 0.23
289 0.29
290 0.33
291 0.38
292 0.45
293 0.52
294 0.61
295 0.69
296 0.77
297 0.81
298 0.82
299 0.83
300 0.8
301 0.82
302 0.8
303 0.79
304 0.76
305 0.69
306 0.62
307 0.52
308 0.44
309 0.33
310 0.25
311 0.19
312 0.12
313 0.11
314 0.11
315 0.12
316 0.12
317 0.13
318 0.14
319 0.16
320 0.16
321 0.15
322 0.14
323 0.12
324 0.12
325 0.1
326 0.09
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.05
333 0.05
334 0.05
335 0.05
336 0.05
337 0.05
338 0.05
339 0.05
340 0.05
341 0.07
342 0.07
343 0.07
344 0.07
345 0.07
346 0.08
347 0.09
348 0.08
349 0.07
350 0.1
351 0.15
352 0.18
353 0.25
354 0.3
355 0.38
356 0.49
357 0.59
358 0.66
359 0.73
360 0.8
361 0.83
362 0.88
363 0.9
364 0.86
365 0.8
366 0.74
367 0.65
368 0.55
369 0.45
370 0.37
371 0.26
372 0.19
373 0.14
374 0.1
375 0.08
376 0.07
377 0.07
378 0.06
379 0.09
380 0.12
381 0.22
382 0.27
383 0.33
384 0.39
385 0.49
386 0.55
387 0.62
388 0.67