Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0N8E5

Protein Details
Accession A0A0L0N8E5    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
194-227AASPKRHDRRPRTSVAPHHKTLRRLAHRNPTRLAHydrophilic
NLS Segment(s)
PositionSequence
194-217AASPKRHDRRPRTSVAPHHKTLRR
Subcellular Location(s) extr 18, plas 4, cyto 2, nucl 1, mito 1, pero 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences ASGAIVSGFGPGALGSRFLWGPAWHSGRDSGSGHRGRALSGSRSTITPAKRPFRRTSVAAEAGRPFSILSLRGPPPFAATLTLPVDDPPPPSTLHPQNPFPNSRPLAPLSAAPCLSLVCLVSHLQSSLSEQRPASHRTAPHRIALRRRHTCFHPTLRLPACLPARPRSAAGSSLCSHTTTRPGDDNDKRRETAAASPKRHDRRPRTSVAPHHKTLRRLAHRNPTRLASGVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.11
4 0.11
5 0.12
6 0.14
7 0.13
8 0.17
9 0.23
10 0.26
11 0.24
12 0.26
13 0.28
14 0.27
15 0.31
16 0.29
17 0.25
18 0.31
19 0.34
20 0.33
21 0.34
22 0.33
23 0.3
24 0.33
25 0.32
26 0.28
27 0.27
28 0.3
29 0.26
30 0.27
31 0.3
32 0.3
33 0.3
34 0.33
35 0.39
36 0.45
37 0.51
38 0.57
39 0.61
40 0.62
41 0.64
42 0.59
43 0.58
44 0.56
45 0.57
46 0.51
47 0.47
48 0.42
49 0.38
50 0.35
51 0.28
52 0.19
53 0.12
54 0.13
55 0.11
56 0.11
57 0.15
58 0.18
59 0.19
60 0.2
61 0.19
62 0.2
63 0.2
64 0.18
65 0.14
66 0.12
67 0.15
68 0.15
69 0.15
70 0.13
71 0.12
72 0.13
73 0.12
74 0.13
75 0.11
76 0.11
77 0.12
78 0.14
79 0.2
80 0.25
81 0.32
82 0.34
83 0.38
84 0.42
85 0.45
86 0.47
87 0.43
88 0.44
89 0.38
90 0.35
91 0.33
92 0.29
93 0.26
94 0.23
95 0.23
96 0.17
97 0.17
98 0.16
99 0.13
100 0.12
101 0.1
102 0.1
103 0.07
104 0.06
105 0.04
106 0.05
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.09
114 0.15
115 0.16
116 0.18
117 0.18
118 0.2
119 0.24
120 0.27
121 0.27
122 0.25
123 0.28
124 0.32
125 0.41
126 0.4
127 0.42
128 0.45
129 0.47
130 0.52
131 0.57
132 0.6
133 0.61
134 0.62
135 0.62
136 0.59
137 0.61
138 0.59
139 0.57
140 0.56
141 0.49
142 0.54
143 0.52
144 0.5
145 0.43
146 0.43
147 0.38
148 0.34
149 0.36
150 0.33
151 0.34
152 0.34
153 0.34
154 0.31
155 0.29
156 0.3
157 0.28
158 0.27
159 0.24
160 0.25
161 0.25
162 0.23
163 0.22
164 0.19
165 0.25
166 0.23
167 0.25
168 0.27
169 0.31
170 0.39
171 0.48
172 0.55
173 0.57
174 0.59
175 0.56
176 0.53
177 0.5
178 0.43
179 0.43
180 0.45
181 0.46
182 0.45
183 0.5
184 0.59
185 0.66
186 0.72
187 0.73
188 0.73
189 0.73
190 0.77
191 0.79
192 0.77
193 0.79
194 0.8
195 0.81
196 0.78
197 0.73
198 0.75
199 0.73
200 0.69
201 0.69
202 0.69
203 0.68
204 0.7
205 0.74
206 0.75
207 0.79
208 0.81
209 0.76
210 0.69
211 0.62