Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0N997

Protein Details
Accession A0A0L0N997    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-51RTVLSHHHHHRQHQHHRHRQLLQHHPYPRHHSQKRRFSPSABasic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010259  S8pro/Inhibitor_I9  
IPR037045  S8pro/Inhibitor_I9_sf  
Pfam View protein in Pfam  
PF05922  Inhibitor_I9  
Amino Acid Sequences MIPTRAGLRARTVLSHHHHHRQHQHHRHRQLLQHHPYPRHHSQKRRFSPSATANMPSYIVTCNDDATPEQIAAAKKHAVDQGGRIGHEYSLIKGFSVEFDKDSITTLESHEHVKAVERDGVMTTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.45
3 0.47
4 0.51
5 0.55
6 0.61
7 0.69
8 0.71
9 0.77
10 0.78
11 0.83
12 0.83
13 0.87
14 0.87
15 0.83
16 0.79
17 0.77
18 0.77
19 0.73
20 0.71
21 0.69
22 0.67
23 0.65
24 0.67
25 0.66
26 0.66
27 0.67
28 0.69
29 0.73
30 0.78
31 0.82
32 0.83
33 0.76
34 0.68
35 0.68
36 0.63
37 0.6
38 0.51
39 0.43
40 0.34
41 0.33
42 0.3
43 0.22
44 0.16
45 0.1
46 0.09
47 0.09
48 0.08
49 0.09
50 0.08
51 0.09
52 0.08
53 0.09
54 0.09
55 0.07
56 0.07
57 0.09
58 0.11
59 0.11
60 0.13
61 0.13
62 0.12
63 0.15
64 0.17
65 0.15
66 0.14
67 0.16
68 0.2
69 0.2
70 0.2
71 0.19
72 0.18
73 0.16
74 0.19
75 0.17
76 0.12
77 0.14
78 0.14
79 0.13
80 0.12
81 0.13
82 0.12
83 0.15
84 0.14
85 0.12
86 0.13
87 0.14
88 0.14
89 0.16
90 0.14
91 0.11
92 0.11
93 0.11
94 0.14
95 0.14
96 0.17
97 0.16
98 0.16
99 0.15
100 0.21
101 0.22
102 0.22
103 0.26
104 0.24
105 0.24