Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0NE81

Protein Details
Accession A0A0L0NE81    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
311-337GKESVVVDRRTKRQRRRKCLSVHGVALHydrophilic
NLS Segment(s)
PositionSequence
320-327RTKRQRRR
Subcellular Location(s) plas 19, mito 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039960  MCP1  
IPR012472  MCP1_TM  
Gene Ontology GO:0016020  C:membrane  
GO:0055088  P:lipid homeostasis  
Pfam View protein in Pfam  
PF07950  MCP1_TM  
Amino Acid Sequences TLELCPTSLLAESSEFGFSFPHRPPHPILRLGMETPGQSDRRDSQQTPISLLQLDPSPMDTPSPSESDRELRLGPDEALDSSAGGVRSGPTAGAPGLSGSGSHGAIYYLTRIQRYSSYAMSIFTSLHLANVSLIPAVTRSVAGSETYLLMTREIYQTSVAEPLLVALPVLAHVGSGVALRLLRRWQNMKRYGGGTPGMYALHRLLRGGDAKSGSRGGSGVRLWPPLSYISISGYVFTIFYSAHAFVNRVLPLAVEGDSSNIGLAYVAHGFARHPVAARVAYAGLIAVGCGHMVWGMAKWLGAAPSTRGWRGKESVVVDRRTKRQRRRKCLSVHGVALAVAAAWAVGGLGTVARGGPAAGWVAKVYDDLFARVGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.13
5 0.14
6 0.18
7 0.21
8 0.29
9 0.3
10 0.35
11 0.41
12 0.49
13 0.55
14 0.54
15 0.53
16 0.5
17 0.51
18 0.47
19 0.44
20 0.36
21 0.29
22 0.26
23 0.3
24 0.25
25 0.22
26 0.26
27 0.27
28 0.33
29 0.4
30 0.39
31 0.4
32 0.46
33 0.47
34 0.47
35 0.45
36 0.39
37 0.32
38 0.31
39 0.25
40 0.19
41 0.19
42 0.14
43 0.15
44 0.14
45 0.13
46 0.15
47 0.13
48 0.15
49 0.17
50 0.2
51 0.19
52 0.2
53 0.22
54 0.26
55 0.27
56 0.27
57 0.25
58 0.22
59 0.24
60 0.23
61 0.21
62 0.17
63 0.16
64 0.13
65 0.14
66 0.12
67 0.1
68 0.08
69 0.1
70 0.09
71 0.08
72 0.08
73 0.07
74 0.08
75 0.08
76 0.08
77 0.06
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.08
88 0.08
89 0.08
90 0.07
91 0.07
92 0.08
93 0.08
94 0.09
95 0.11
96 0.12
97 0.13
98 0.14
99 0.15
100 0.17
101 0.21
102 0.22
103 0.19
104 0.2
105 0.19
106 0.2
107 0.19
108 0.17
109 0.13
110 0.11
111 0.12
112 0.09
113 0.09
114 0.08
115 0.08
116 0.08
117 0.08
118 0.07
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.06
131 0.07
132 0.07
133 0.07
134 0.08
135 0.07
136 0.07
137 0.07
138 0.08
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.1
146 0.09
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.05
153 0.03
154 0.03
155 0.03
156 0.04
157 0.03
158 0.02
159 0.02
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.05
168 0.09
169 0.11
170 0.15
171 0.22
172 0.27
173 0.36
174 0.43
175 0.44
176 0.44
177 0.43
178 0.4
179 0.36
180 0.32
181 0.23
182 0.16
183 0.14
184 0.12
185 0.1
186 0.1
187 0.08
188 0.09
189 0.09
190 0.08
191 0.08
192 0.1
193 0.13
194 0.13
195 0.14
196 0.13
197 0.14
198 0.15
199 0.16
200 0.13
201 0.11
202 0.11
203 0.09
204 0.11
205 0.11
206 0.13
207 0.14
208 0.16
209 0.16
210 0.15
211 0.16
212 0.14
213 0.14
214 0.11
215 0.1
216 0.1
217 0.12
218 0.12
219 0.11
220 0.11
221 0.1
222 0.09
223 0.08
224 0.07
225 0.05
226 0.05
227 0.08
228 0.08
229 0.09
230 0.1
231 0.11
232 0.11
233 0.15
234 0.15
235 0.13
236 0.12
237 0.1
238 0.11
239 0.11
240 0.1
241 0.07
242 0.07
243 0.07
244 0.08
245 0.08
246 0.07
247 0.05
248 0.05
249 0.04
250 0.04
251 0.05
252 0.05
253 0.05
254 0.05
255 0.06
256 0.06
257 0.09
258 0.11
259 0.1
260 0.11
261 0.12
262 0.15
263 0.15
264 0.15
265 0.14
266 0.12
267 0.11
268 0.1
269 0.09
270 0.06
271 0.05
272 0.05
273 0.03
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.03
280 0.04
281 0.04
282 0.06
283 0.06
284 0.06
285 0.07
286 0.08
287 0.08
288 0.09
289 0.09
290 0.11
291 0.16
292 0.2
293 0.24
294 0.27
295 0.29
296 0.33
297 0.36
298 0.36
299 0.37
300 0.38
301 0.44
302 0.47
303 0.5
304 0.52
305 0.56
306 0.62
307 0.67
308 0.73
309 0.74
310 0.78
311 0.84
312 0.87
313 0.9
314 0.9
315 0.89
316 0.9
317 0.88
318 0.85
319 0.76
320 0.67
321 0.57
322 0.48
323 0.38
324 0.27
325 0.16
326 0.09
327 0.05
328 0.03
329 0.02
330 0.02
331 0.02
332 0.02
333 0.02
334 0.02
335 0.02
336 0.03
337 0.03
338 0.04
339 0.04
340 0.04
341 0.04
342 0.04
343 0.06
344 0.08
345 0.08
346 0.09
347 0.1
348 0.1
349 0.11
350 0.12
351 0.11
352 0.13
353 0.14
354 0.15