Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0NJ57

Protein Details
Accession A0A0L0NJ57    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKVKDKAQHAVLHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 12, mito 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKVKDKAQHAVLLDKATSEKLYKDVQSYRLVTVAVLVDRMKVNGSLARQCIADLEEKGMIKPIVTHSKMKIYTRAVGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.48
14 0.39
15 0.33
16 0.25
17 0.18
18 0.16
19 0.13
20 0.13
21 0.11
22 0.1
23 0.11
24 0.14
25 0.15
26 0.18
27 0.21
28 0.23
29 0.27
30 0.28
31 0.25
32 0.23
33 0.22
34 0.17
35 0.15
36 0.12
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.09
47 0.12
48 0.14
49 0.15
50 0.16
51 0.16
52 0.16
53 0.15
54 0.14
55 0.15
56 0.12
57 0.13
58 0.15
59 0.15
60 0.15
61 0.18
62 0.16
63 0.13
64 0.15
65 0.19
66 0.26
67 0.29
68 0.33
69 0.33
70 0.42
71 0.48
72 0.49
73 0.5
74 0.45
75 0.47