Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0N4U0

Protein Details
Accession A0A0L0N4U0   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20STGGSRKRAPRYSGKPRNAGHydrophilic
106-125FSLMSGWKRRTARRKGRCPTHydrophilic
NLS Segment(s)
PositionSequence
114-120RRTARRK
Subcellular Location(s) mito 15, nucl 4, golg 3, cyto 2, plas 1, pero 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00106  adh_short  
Amino Acid Sequences STGGSRKRAPRYSGKPRNAGISIETSQPPTKTHETLEDVWDTTITVNAKSVFLDCKYATAQMLRQDVLPSSDRGWIFNMSSIFGLVAGYYVCKLPLLICSLYGPSFSLMSGWKRRTARRKGRCPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.77
3 0.72
4 0.72
5 0.63
6 0.54
7 0.45
8 0.4
9 0.34
10 0.3
11 0.29
12 0.26
13 0.26
14 0.26
15 0.25
16 0.25
17 0.28
18 0.26
19 0.27
20 0.29
21 0.32
22 0.33
23 0.34
24 0.29
25 0.25
26 0.23
27 0.21
28 0.16
29 0.11
30 0.12
31 0.09
32 0.08
33 0.09
34 0.1
35 0.1
36 0.1
37 0.11
38 0.1
39 0.1
40 0.13
41 0.11
42 0.13
43 0.13
44 0.13
45 0.13
46 0.12
47 0.14
48 0.15
49 0.16
50 0.15
51 0.15
52 0.14
53 0.14
54 0.16
55 0.15
56 0.11
57 0.11
58 0.15
59 0.15
60 0.15
61 0.17
62 0.16
63 0.15
64 0.17
65 0.16
66 0.12
67 0.12
68 0.11
69 0.09
70 0.08
71 0.08
72 0.04
73 0.04
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.08
83 0.12
84 0.12
85 0.12
86 0.14
87 0.15
88 0.16
89 0.15
90 0.14
91 0.11
92 0.11
93 0.1
94 0.1
95 0.12
96 0.19
97 0.27
98 0.29
99 0.36
100 0.42
101 0.52
102 0.61
103 0.69
104 0.73
105 0.75