Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NK97

Protein Details
Accession A0A0L0NK97    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-83EDSGKKAPAKKAHAKKAPAKKAPAKKSNGIHydrophilic
87-114KDTISPPKVNPRSKPRAKPKTKTVMPGMHydrophilic
660-682RRNAMRRRGLDPRSNKKAKKQSKBasic
NLS Segment(s)
PositionSequence
42-107NKRRRTAKATEAEDSGKKAPAKKAHAKKAPAKKAPAKKSNGINTAKDTISPPKVNPRSKPRAKPKT
659-683KGRRNAMRRRGLDPRSNKKAKKQSK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018314  Fmu/NOL1/Nop2p_CS  
IPR031341  Methyltr_RsmF_N  
IPR001678  MeTrfase_RsmB/NOP2  
IPR011023  Nop2p  
IPR023267  RCMT  
IPR023273  RCMT_NOP2  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003723  F:RNA binding  
GO:0008173  F:RNA methyltransferase activity  
GO:0008757  F:S-adenosylmethionine-dependent methyltransferase activity  
GO:0042254  P:ribosome biogenesis  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF01189  Methyltr_RsmB-F  
PF17125  Methyltr_RsmF_N  
PROSITE View protein in PROSITE  
PS01153  NOL1_NOP2_SUN  
PS51686  SAM_MT_RSMB_NOP  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MGAGRRMARKQGPPEPLSEEHFARLKRKAALPVDPPVEAQNNKRRRTAKATEAEDSGKKAPAKKAHAKKAPAKKAPAKKSNGINTAKDTISPPKVNPRSKPRAKPKTKTVMPGMEDSDEDLDEDLDDEFDLEEADLSDGDDVPATLGDDFLGSDSGSSVFDSDDGGDQGKHTFSEDEDESDAEETLTAAXIAGLSRKLDRQLAEQAAASAAELAESAMKTNIDGDKPHILDDEDDEDGLAGKTNALLAPDLQLLRTRISENIRVLDDFSKLAEEGRSRAEYTAQLIKDVCAYYGYSEYLAEKLYNLFTPREAFAFFEANETARPVVIRTNTLRTHRRDLAQALINRGVTLEPVGKWSKVGLQIFESNVPLGATPEYLAGHYILQAASSFLPCMALEPQENERVLDMAAAPGGKTTYMAALMKNTGIIIANDPNKSRAKGLIGNIHRLGARNVIVSNYDAREFPKPMGGFDRVLLDAPCSGTGVIAKDPSVKTNKAEMDFMQLPHTQKQLLLAAIDSVNHASKTGGYIVYSTCSVTIEENEQVVQYALSRRPNVRLVDTGLTFGKEGFTSFMGKQFDASLKLTRRYYPHTYNVDGFYVAKFKKISPTPAKASASRDKATLSADEEVIDRTPISAEEDDTAAANDNFGGWDEEEDKEYMEKGRRNAMRRRGLDPRSNKKAKKQSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.63
3 0.58
4 0.55
5 0.5
6 0.43
7 0.38
8 0.42
9 0.41
10 0.39
11 0.42
12 0.42
13 0.44
14 0.48
15 0.53
16 0.54
17 0.59
18 0.58
19 0.6
20 0.57
21 0.51
22 0.46
23 0.41
24 0.42
25 0.37
26 0.41
27 0.43
28 0.49
29 0.53
30 0.6
31 0.6
32 0.61
33 0.68
34 0.67
35 0.68
36 0.68
37 0.7
38 0.65
39 0.64
40 0.61
41 0.53
42 0.49
43 0.41
44 0.37
45 0.34
46 0.37
47 0.42
48 0.46
49 0.53
50 0.6
51 0.68
52 0.73
53 0.79
54 0.82
55 0.83
56 0.85
57 0.87
58 0.84
59 0.83
60 0.83
61 0.84
62 0.86
63 0.86
64 0.82
65 0.78
66 0.8
67 0.79
68 0.78
69 0.73
70 0.66
71 0.62
72 0.6
73 0.52
74 0.44
75 0.38
76 0.37
77 0.39
78 0.39
79 0.36
80 0.43
81 0.52
82 0.58
83 0.64
84 0.67
85 0.7
86 0.77
87 0.85
88 0.85
89 0.87
90 0.9
91 0.9
92 0.9
93 0.9
94 0.86
95 0.83
96 0.79
97 0.76
98 0.68
99 0.63
100 0.54
101 0.44
102 0.38
103 0.32
104 0.25
105 0.17
106 0.15
107 0.11
108 0.09
109 0.07
110 0.08
111 0.07
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.04
119 0.04
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.05
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.07
149 0.07
150 0.07
151 0.08
152 0.09
153 0.08
154 0.09
155 0.1
156 0.1
157 0.09
158 0.1
159 0.1
160 0.09
161 0.14
162 0.15
163 0.16
164 0.16
165 0.16
166 0.15
167 0.15
168 0.15
169 0.09
170 0.08
171 0.06
172 0.05
173 0.05
174 0.04
175 0.03
176 0.03
177 0.05
178 0.05
179 0.06
180 0.07
181 0.08
182 0.1
183 0.12
184 0.15
185 0.15
186 0.19
187 0.25
188 0.26
189 0.27
190 0.26
191 0.24
192 0.21
193 0.19
194 0.15
195 0.08
196 0.05
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.05
203 0.06
204 0.06
205 0.06
206 0.09
207 0.11
208 0.11
209 0.12
210 0.15
211 0.21
212 0.21
213 0.21
214 0.2
215 0.17
216 0.17
217 0.18
218 0.18
219 0.12
220 0.11
221 0.11
222 0.1
223 0.1
224 0.09
225 0.07
226 0.04
227 0.04
228 0.04
229 0.05
230 0.05
231 0.05
232 0.05
233 0.05
234 0.07
235 0.09
236 0.09
237 0.09
238 0.11
239 0.12
240 0.13
241 0.14
242 0.13
243 0.15
244 0.19
245 0.24
246 0.23
247 0.25
248 0.24
249 0.23
250 0.24
251 0.21
252 0.19
253 0.13
254 0.12
255 0.1
256 0.09
257 0.1
258 0.1
259 0.09
260 0.1
261 0.13
262 0.14
263 0.14
264 0.15
265 0.15
266 0.14
267 0.16
268 0.21
269 0.18
270 0.18
271 0.17
272 0.17
273 0.17
274 0.17
275 0.14
276 0.08
277 0.08
278 0.08
279 0.09
280 0.09
281 0.07
282 0.08
283 0.08
284 0.08
285 0.08
286 0.07
287 0.06
288 0.07
289 0.07
290 0.08
291 0.1
292 0.09
293 0.1
294 0.12
295 0.12
296 0.12
297 0.11
298 0.11
299 0.11
300 0.12
301 0.11
302 0.11
303 0.11
304 0.1
305 0.1
306 0.1
307 0.08
308 0.07
309 0.07
310 0.06
311 0.09
312 0.09
313 0.12
314 0.14
315 0.2
316 0.23
317 0.29
318 0.35
319 0.37
320 0.42
321 0.43
322 0.42
323 0.39
324 0.37
325 0.36
326 0.35
327 0.32
328 0.28
329 0.26
330 0.24
331 0.21
332 0.2
333 0.14
334 0.09
335 0.08
336 0.07
337 0.06
338 0.1
339 0.11
340 0.1
341 0.11
342 0.11
343 0.13
344 0.17
345 0.18
346 0.15
347 0.16
348 0.18
349 0.19
350 0.19
351 0.16
352 0.11
353 0.1
354 0.09
355 0.07
356 0.06
357 0.05
358 0.05
359 0.05
360 0.06
361 0.06
362 0.06
363 0.06
364 0.06
365 0.06
366 0.06
367 0.06
368 0.06
369 0.05
370 0.05
371 0.06
372 0.06
373 0.06
374 0.05
375 0.05
376 0.05
377 0.05
378 0.06
379 0.07
380 0.08
381 0.08
382 0.11
383 0.13
384 0.16
385 0.16
386 0.15
387 0.14
388 0.13
389 0.13
390 0.1
391 0.08
392 0.05
393 0.05
394 0.05
395 0.05
396 0.04
397 0.05
398 0.04
399 0.04
400 0.04
401 0.04
402 0.06
403 0.07
404 0.07
405 0.09
406 0.09
407 0.09
408 0.09
409 0.08
410 0.06
411 0.06
412 0.07
413 0.07
414 0.12
415 0.15
416 0.17
417 0.18
418 0.21
419 0.23
420 0.24
421 0.23
422 0.2
423 0.21
424 0.25
425 0.28
426 0.33
427 0.33
428 0.38
429 0.37
430 0.35
431 0.32
432 0.28
433 0.25
434 0.19
435 0.17
436 0.13
437 0.13
438 0.13
439 0.13
440 0.13
441 0.14
442 0.12
443 0.12
444 0.12
445 0.14
446 0.17
447 0.18
448 0.17
449 0.21
450 0.2
451 0.21
452 0.25
453 0.26
454 0.22
455 0.22
456 0.24
457 0.17
458 0.18
459 0.17
460 0.13
461 0.11
462 0.11
463 0.1
464 0.08
465 0.07
466 0.07
467 0.08
468 0.09
469 0.09
470 0.09
471 0.1
472 0.14
473 0.15
474 0.19
475 0.23
476 0.23
477 0.25
478 0.31
479 0.35
480 0.32
481 0.34
482 0.29
483 0.32
484 0.33
485 0.31
486 0.27
487 0.26
488 0.27
489 0.28
490 0.29
491 0.21
492 0.19
493 0.21
494 0.2
495 0.18
496 0.16
497 0.13
498 0.13
499 0.13
500 0.13
501 0.1
502 0.09
503 0.1
504 0.09
505 0.09
506 0.08
507 0.08
508 0.1
509 0.12
510 0.11
511 0.1
512 0.11
513 0.11
514 0.13
515 0.13
516 0.11
517 0.09
518 0.09
519 0.1
520 0.1
521 0.11
522 0.13
523 0.14
524 0.14
525 0.14
526 0.13
527 0.13
528 0.12
529 0.1
530 0.09
531 0.13
532 0.17
533 0.22
534 0.26
535 0.28
536 0.33
537 0.39
538 0.4
539 0.39
540 0.38
541 0.37
542 0.37
543 0.35
544 0.33
545 0.28
546 0.25
547 0.21
548 0.18
549 0.15
550 0.1
551 0.1
552 0.1
553 0.1
554 0.14
555 0.14
556 0.2
557 0.21
558 0.21
559 0.21
560 0.22
561 0.23
562 0.23
563 0.25
564 0.27
565 0.3
566 0.36
567 0.38
568 0.39
569 0.42
570 0.46
571 0.52
572 0.52
573 0.56
574 0.56
575 0.58
576 0.57
577 0.54
578 0.48
579 0.4
580 0.34
581 0.26
582 0.27
583 0.23
584 0.23
585 0.22
586 0.22
587 0.31
588 0.35
589 0.44
590 0.46
591 0.54
592 0.57
593 0.64
594 0.66
595 0.61
596 0.63
597 0.62
598 0.6
599 0.53
600 0.48
601 0.41
602 0.38
603 0.37
604 0.32
605 0.27
606 0.22
607 0.21
608 0.2
609 0.2
610 0.2
611 0.18
612 0.15
613 0.12
614 0.09
615 0.1
616 0.1
617 0.14
618 0.14
619 0.14
620 0.15
621 0.16
622 0.16
623 0.15
624 0.15
625 0.13
626 0.12
627 0.11
628 0.09
629 0.09
630 0.09
631 0.1
632 0.11
633 0.09
634 0.12
635 0.14
636 0.15
637 0.17
638 0.17
639 0.17
640 0.16
641 0.17
642 0.2
643 0.26
644 0.3
645 0.31
646 0.41
647 0.47
648 0.54
649 0.63
650 0.67
651 0.7
652 0.69
653 0.73
654 0.73
655 0.74
656 0.77
657 0.77
658 0.78
659 0.78
660 0.84
661 0.83
662 0.83