Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CW78

Protein Details
Accession Q6CW78   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-42AAMAGGKKSKKKWSKKSHKDKAKHAVVLHydrophilic
NLS Segment(s)
PositionSequence
11-37AKAAAAMAGGKKSKKKWSKKSHKDKAK
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG kla:KLLA0_B06182g  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQLSKAAKAAAAMAGGKKSKKKWSKKSHKDKAKHAVVLDQDKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKHSKQAIYTRATASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.17
4 0.14
5 0.15
6 0.17
7 0.21
8 0.25
9 0.3
10 0.39
11 0.48
12 0.57
13 0.65
14 0.73
15 0.82
16 0.87
17 0.93
18 0.94
19 0.94
20 0.91
21 0.9
22 0.88
23 0.84
24 0.76
25 0.65
26 0.59
27 0.53
28 0.52
29 0.43
30 0.34
31 0.27
32 0.24
33 0.25
34 0.22
35 0.18
36 0.12
37 0.15
38 0.14
39 0.19
40 0.22
41 0.23
42 0.25
43 0.26
44 0.25
45 0.22
46 0.22
47 0.17
48 0.15
49 0.14
50 0.12
51 0.11
52 0.11
53 0.1
54 0.1
55 0.1
56 0.08
57 0.07
58 0.07
59 0.09
60 0.1
61 0.12
62 0.13
63 0.15
64 0.15
65 0.15
66 0.19
67 0.17
68 0.16
69 0.15
70 0.14
71 0.13
72 0.15
73 0.15
74 0.13
75 0.12
76 0.13
77 0.13
78 0.21
79 0.29
80 0.29
81 0.35
82 0.4
83 0.48
84 0.52
85 0.59
86 0.58
87 0.54
88 0.56