Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NEK7

Protein Details
Accession A0A0L0NEK7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
73-100VSLSGGKRKRQRDSLRNHPQKRDFQQGYHydrophilic
NLS Segment(s)
PositionSequence
68-84KYKRIVSLSGGKRKRQR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, cyto 4.5, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MLMSWGGEMAAEAGLPDLEAEVLRSSQAVWDEGVGHNDERDPNLLWNDERSRVMLIDFDRAALRPAPKYKRIVSLSGGKRKRQRDSLRNHPQKRDFQQGYLQSVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.04
6 0.04
7 0.05
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.08
14 0.09
15 0.09
16 0.08
17 0.08
18 0.1
19 0.11
20 0.12
21 0.12
22 0.1
23 0.1
24 0.11
25 0.11
26 0.1
27 0.11
28 0.11
29 0.11
30 0.12
31 0.14
32 0.13
33 0.16
34 0.17
35 0.17
36 0.17
37 0.16
38 0.15
39 0.14
40 0.14
41 0.12
42 0.11
43 0.12
44 0.11
45 0.11
46 0.11
47 0.11
48 0.12
49 0.12
50 0.13
51 0.15
52 0.23
53 0.28
54 0.33
55 0.38
56 0.39
57 0.46
58 0.47
59 0.45
60 0.42
61 0.46
62 0.5
63 0.55
64 0.57
65 0.55
66 0.6
67 0.65
68 0.69
69 0.7
70 0.72
71 0.71
72 0.76
73 0.8
74 0.84
75 0.87
76 0.87
77 0.86
78 0.84
79 0.84
80 0.81
81 0.81
82 0.73
83 0.66
84 0.68
85 0.64