Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0N6Y6

Protein Details
Accession A0A0L0N6Y6    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-117WPTTRRSPMPSKRPWRRCRIPLPLRHydrophilic
NLS Segment(s)
PositionSequence
92-120KPWPTTRRSPMPSKRPWRRCRIPLPLRPP
126-126R
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MTRGNPTSSQQDPAIQPLHRPSARPSPGTPRSNVLCAPYKVLSSNCANCFXPKQRGISNLLVKTAAHTQWPPPRPSDTLAAKTPRRSWSSSKPWPTTRRSPMPSKRPWRRCRIPLPLRPPTTPPTRRPSPTPSQYRRPARRAACSSSPQRARPSPWRCTFTTTAPGDPDQASTSRTFLSSPRREARAMASACSSSWPGRSSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.33
4 0.34
5 0.42
6 0.38
7 0.39
8 0.39
9 0.45
10 0.5
11 0.5
12 0.48
13 0.49
14 0.57
15 0.59
16 0.55
17 0.51
18 0.49
19 0.48
20 0.45
21 0.4
22 0.38
23 0.35
24 0.37
25 0.32
26 0.29
27 0.29
28 0.28
29 0.27
30 0.26
31 0.32
32 0.3
33 0.36
34 0.37
35 0.37
36 0.44
37 0.43
38 0.46
39 0.43
40 0.44
41 0.42
42 0.45
43 0.49
44 0.49
45 0.46
46 0.39
47 0.35
48 0.31
49 0.28
50 0.27
51 0.21
52 0.15
53 0.15
54 0.21
55 0.29
56 0.34
57 0.34
58 0.32
59 0.35
60 0.35
61 0.36
62 0.38
63 0.34
64 0.33
65 0.36
66 0.4
67 0.39
68 0.41
69 0.43
70 0.41
71 0.4
72 0.39
73 0.41
74 0.45
75 0.52
76 0.57
77 0.61
78 0.6
79 0.64
80 0.67
81 0.67
82 0.66
83 0.64
84 0.63
85 0.6
86 0.64
87 0.65
88 0.68
89 0.72
90 0.73
91 0.76
92 0.78
93 0.81
94 0.81
95 0.81
96 0.8
97 0.8
98 0.8
99 0.8
100 0.78
101 0.79
102 0.77
103 0.72
104 0.65
105 0.6
106 0.53
107 0.54
108 0.52
109 0.49
110 0.48
111 0.51
112 0.53
113 0.54
114 0.57
115 0.57
116 0.6
117 0.64
118 0.63
119 0.66
120 0.73
121 0.78
122 0.79
123 0.74
124 0.74
125 0.68
126 0.71
127 0.68
128 0.65
129 0.61
130 0.59
131 0.6
132 0.61
133 0.61
134 0.56
135 0.57
136 0.54
137 0.55
138 0.59
139 0.61
140 0.61
141 0.63
142 0.64
143 0.59
144 0.61
145 0.58
146 0.52
147 0.53
148 0.46
149 0.4
150 0.38
151 0.37
152 0.33
153 0.3
154 0.27
155 0.2
156 0.18
157 0.18
158 0.16
159 0.17
160 0.15
161 0.15
162 0.15
163 0.18
164 0.28
165 0.33
166 0.41
167 0.46
168 0.49
169 0.49
170 0.5
171 0.5
172 0.49
173 0.43
174 0.37
175 0.33
176 0.3
177 0.29
178 0.3
179 0.27
180 0.19
181 0.21