Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0MY22

Protein Details
Accession A0A0L0MY22    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-50VLRLRGGGKKRKKKVYTTPKKIKHKRKKTKMAVLKYYKVBasic
NLS Segment(s)
PositionSequence
15-41LRGGGKKRKKKVYTTPKKIKHKRKKTK
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
Amino Acid Sequences YNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKRKKTKMAVLKYYKVDKDGNIERLRRECPSDTCGAGVFMASMPDRQYCGRCHLTYVFDKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.26
4 0.34
5 0.39
6 0.46
7 0.55
8 0.63
9 0.71
10 0.75
11 0.8
12 0.83
13 0.85
14 0.86
15 0.86
16 0.87
17 0.87
18 0.92
19 0.93
20 0.93
21 0.92
22 0.92
23 0.93
24 0.93
25 0.94
26 0.93
27 0.93
28 0.91
29 0.88
30 0.86
31 0.81
32 0.74
33 0.67
34 0.6
35 0.5
36 0.43
37 0.36
38 0.27
39 0.28
40 0.28
41 0.32
42 0.33
43 0.34
44 0.34
45 0.36
46 0.38
47 0.33
48 0.32
49 0.29
50 0.27
51 0.3
52 0.3
53 0.27
54 0.26
55 0.24
56 0.2
57 0.17
58 0.13
59 0.09
60 0.06
61 0.07
62 0.07
63 0.08
64 0.09
65 0.1
66 0.12
67 0.15
68 0.18
69 0.19
70 0.27
71 0.33
72 0.32
73 0.36
74 0.38
75 0.41