Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NE31

Protein Details
Accession A0A0L0NE31    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
64-93LPPARHKKLLRLSEKKRKRKDANLENFVRNHydrophilic
NLS Segment(s)
PositionSequence
67-83ARHKKLLRLSEKKRKRK
Subcellular Location(s) nucl 12, cyto_nucl 11, cyto 8, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002575  Aminoglycoside_PTrfase  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF01636  APH  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MSWAGGKVEAATAGVPDLAAEVMRSLRPVLAEGVVHDDLRKANMLWNAERRRVMIIDFDRATLLPPARHKKLLRLSEKKRKRKDANLENFVRNHVLRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.06
11 0.07
12 0.07
13 0.08
14 0.08
15 0.09
16 0.1
17 0.09
18 0.09
19 0.09
20 0.14
21 0.14
22 0.14
23 0.12
24 0.12
25 0.11
26 0.12
27 0.13
28 0.07
29 0.11
30 0.14
31 0.16
32 0.18
33 0.27
34 0.29
35 0.31
36 0.31
37 0.28
38 0.27
39 0.25
40 0.22
41 0.2
42 0.19
43 0.21
44 0.21
45 0.2
46 0.19
47 0.19
48 0.19
49 0.15
50 0.15
51 0.14
52 0.21
53 0.28
54 0.32
55 0.39
56 0.39
57 0.45
58 0.53
59 0.6
60 0.62
61 0.66
62 0.72
63 0.77
64 0.86
65 0.88
66 0.88
67 0.9
68 0.89
69 0.89
70 0.9
71 0.9
72 0.9
73 0.89
74 0.85
75 0.8
76 0.71
77 0.63
78 0.57
79 0.46