Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0N7N8

Protein Details
Accession A0A0L0N7N8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-86PRCPPFRDRYGRRSRSRRPLSLBasic
NLS Segment(s)
PositionSequence
79-79R
Subcellular Location(s) mito 17, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008914  PEBP  
IPR036610  PEBP-like_sf  
Pfam View protein in Pfam  
PF01161  PBP  
Amino Acid Sequences MPTKASVKRILGAMKKVGCWVSLSTARRSRRSNTPPVPWYEIPRPRQIPQSDHRHSGSICPRDIPRCPPFRDRYGRRSRSRRPLSLIRPSRSHPALDPAGLQSRPQPRLDFQRSFVANYIGPAPPAGSPHRYAFFLFERPEDFNSKTYALAGGNPLNNWHRMRYDLDVWQKTAKLCEPLATNYFLSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.42
4 0.39
5 0.31
6 0.27
7 0.24
8 0.23
9 0.29
10 0.31
11 0.36
12 0.43
13 0.49
14 0.53
15 0.56
16 0.55
17 0.58
18 0.64
19 0.66
20 0.66
21 0.69
22 0.68
23 0.69
24 0.71
25 0.62
26 0.61
27 0.59
28 0.6
29 0.55
30 0.58
31 0.57
32 0.52
33 0.58
34 0.56
35 0.53
36 0.54
37 0.6
38 0.55
39 0.56
40 0.54
41 0.48
42 0.44
43 0.45
44 0.45
45 0.4
46 0.36
47 0.34
48 0.35
49 0.37
50 0.39
51 0.39
52 0.38
53 0.41
54 0.45
55 0.5
56 0.53
57 0.57
58 0.64
59 0.63
60 0.66
61 0.7
62 0.74
63 0.75
64 0.8
65 0.8
66 0.81
67 0.82
68 0.76
69 0.72
70 0.72
71 0.69
72 0.7
73 0.69
74 0.61
75 0.56
76 0.54
77 0.53
78 0.45
79 0.38
80 0.28
81 0.26
82 0.23
83 0.21
84 0.19
85 0.15
86 0.17
87 0.16
88 0.16
89 0.16
90 0.22
91 0.24
92 0.25
93 0.25
94 0.25
95 0.35
96 0.42
97 0.39
98 0.35
99 0.4
100 0.39
101 0.39
102 0.37
103 0.29
104 0.22
105 0.2
106 0.2
107 0.12
108 0.12
109 0.1
110 0.1
111 0.09
112 0.11
113 0.14
114 0.14
115 0.17
116 0.19
117 0.21
118 0.21
119 0.21
120 0.23
121 0.23
122 0.25
123 0.24
124 0.22
125 0.23
126 0.25
127 0.27
128 0.27
129 0.26
130 0.23
131 0.25
132 0.24
133 0.21
134 0.2
135 0.19
136 0.15
137 0.14
138 0.16
139 0.17
140 0.17
141 0.17
142 0.21
143 0.21
144 0.26
145 0.27
146 0.26
147 0.24
148 0.26
149 0.3
150 0.32
151 0.34
152 0.37
153 0.45
154 0.45
155 0.46
156 0.46
157 0.45
158 0.4
159 0.4
160 0.36
161 0.32
162 0.29
163 0.31
164 0.32
165 0.35
166 0.36
167 0.35