Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NHP8

Protein Details
Accession A0A0L0NHP8   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
110-136PWTAERGIGCRRRRRRAGPHCTSPSLTHydrophilic
NLS Segment(s)
PositionSequence
121-125RRRRR
Subcellular Location(s) nucl 12, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MLVYGVHTRTFGPRPANPSGPLASPFLGKGVRRIPEPTATRGQSSAQSGRGIASVTRPPGGTRSRPAWRVRAASYDASGTCSWARLGSRAASTSWEHARRRVCLLARLKPWTAERGIGCRRRRRRAGPHCTSPSLTPLPSTYMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.48
4 0.44
5 0.44
6 0.41
7 0.36
8 0.34
9 0.3
10 0.24
11 0.2
12 0.18
13 0.17
14 0.19
15 0.17
16 0.2
17 0.24
18 0.26
19 0.27
20 0.3
21 0.3
22 0.35
23 0.38
24 0.38
25 0.4
26 0.38
27 0.37
28 0.36
29 0.34
30 0.29
31 0.3
32 0.27
33 0.22
34 0.21
35 0.2
36 0.19
37 0.18
38 0.15
39 0.11
40 0.12
41 0.13
42 0.13
43 0.14
44 0.14
45 0.14
46 0.18
47 0.22
48 0.22
49 0.23
50 0.28
51 0.32
52 0.38
53 0.4
54 0.41
55 0.41
56 0.4
57 0.38
58 0.35
59 0.33
60 0.28
61 0.25
62 0.21
63 0.17
64 0.17
65 0.15
66 0.13
67 0.11
68 0.1
69 0.1
70 0.1
71 0.11
72 0.09
73 0.11
74 0.11
75 0.13
76 0.13
77 0.13
78 0.15
79 0.15
80 0.18
81 0.23
82 0.28
83 0.28
84 0.33
85 0.36
86 0.36
87 0.39
88 0.41
89 0.36
90 0.38
91 0.44
92 0.47
93 0.48
94 0.51
95 0.47
96 0.45
97 0.45
98 0.41
99 0.35
100 0.32
101 0.29
102 0.33
103 0.41
104 0.46
105 0.52
106 0.58
107 0.67
108 0.72
109 0.79
110 0.81
111 0.84
112 0.86
113 0.89
114 0.88
115 0.89
116 0.86
117 0.81
118 0.73
119 0.63
120 0.59
121 0.52
122 0.43
123 0.34
124 0.29