Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0N4P2

Protein Details
Accession A0A0L0N4P2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
249-272QGELASRQWKDRRRNRSRRQSEGPHydrophilic
NLS Segment(s)
PositionSequence
260-267RRRNRSRR
Subcellular Location(s) plas 16, E.R. 4, vacu 3, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALGNLGYVSIAELVVYIPALVLAIIVCRRHGLHRASGWMYTVILCVVRIAGSICQLITYTDQSEGLLKATFTIDSIGISPLLLATLGMLSRLVDWINSKGTTIFSIKQFRIVQLLISIGLILSIAGGSSASTSADGTVTTSSTSKVAIVLYIVAFAGLSYILVTTAGYRTAVPLQERRIPVALAIAWPFILVRLLYSTLAVFVQNDIFSLVGGSIAVRVGMAIVEEFIVVIDYLVLGYSLQKLEPEQQGELASRQWKDRRRNRSRRQSEGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.03
6 0.04
7 0.04
8 0.03
9 0.03
10 0.03
11 0.06
12 0.09
13 0.1
14 0.1
15 0.12
16 0.14
17 0.18
18 0.26
19 0.27
20 0.32
21 0.35
22 0.42
23 0.42
24 0.41
25 0.38
26 0.32
27 0.28
28 0.2
29 0.17
30 0.11
31 0.1
32 0.09
33 0.07
34 0.07
35 0.06
36 0.06
37 0.07
38 0.07
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.1
45 0.11
46 0.12
47 0.12
48 0.12
49 0.12
50 0.12
51 0.14
52 0.13
53 0.12
54 0.1
55 0.09
56 0.09
57 0.1
58 0.09
59 0.08
60 0.08
61 0.07
62 0.07
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.05
69 0.05
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.07
83 0.09
84 0.11
85 0.11
86 0.11
87 0.11
88 0.12
89 0.13
90 0.15
91 0.15
92 0.18
93 0.24
94 0.24
95 0.3
96 0.3
97 0.28
98 0.29
99 0.26
100 0.21
101 0.16
102 0.16
103 0.09
104 0.08
105 0.08
106 0.04
107 0.04
108 0.03
109 0.03
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.03
118 0.03
119 0.03
120 0.03
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.04
141 0.04
142 0.03
143 0.03
144 0.03
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.03
151 0.03
152 0.03
153 0.04
154 0.04
155 0.05
156 0.05
157 0.06
158 0.09
159 0.11
160 0.13
161 0.17
162 0.2
163 0.26
164 0.27
165 0.28
166 0.27
167 0.25
168 0.22
169 0.2
170 0.16
171 0.12
172 0.12
173 0.09
174 0.08
175 0.08
176 0.08
177 0.06
178 0.06
179 0.05
180 0.05
181 0.06
182 0.08
183 0.08
184 0.08
185 0.08
186 0.08
187 0.08
188 0.08
189 0.07
190 0.06
191 0.08
192 0.07
193 0.07
194 0.07
195 0.07
196 0.06
197 0.06
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.03
206 0.03
207 0.03
208 0.03
209 0.04
210 0.03
211 0.03
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.03
220 0.03
221 0.03
222 0.03
223 0.04
224 0.03
225 0.04
226 0.07
227 0.08
228 0.08
229 0.09
230 0.11
231 0.17
232 0.23
233 0.25
234 0.24
235 0.25
236 0.26
237 0.28
238 0.27
239 0.26
240 0.26
241 0.25
242 0.32
243 0.39
244 0.46
245 0.55
246 0.63
247 0.7
248 0.76
249 0.85
250 0.89
251 0.92
252 0.93