Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NK02

Protein Details
Accession A0A0L0NK02   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
70-97EAPTPQSTPKKRKTPRKVATGPKKKAKAHydrophilic
NLS Segment(s)
PositionSequence
79-105PKKRKTPRKVATGPKKKAKAAVKGEAS
109-114DKAKAK
Subcellular Location(s) nucl 11.5, cyto 9.5, mito_nucl 8.833, cyto_mito 7.833, mito 5
Family & Domain DBs
Amino Acid Sequences MSKQDVSEQVKFLVSCIRNATSGKPDFAAVATELEIVSKAAAQKRYERLLKAHDVNGTKAAAAKTSEDVEAXPTPQSTPKKRKTPRKVATGPKKKAKAAVKGEASDEEDKAKAKLVKKEEKEDDSGLSEPPASDGEVEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.27
4 0.27
5 0.27
6 0.28
7 0.32
8 0.31
9 0.33
10 0.31
11 0.28
12 0.26
13 0.24
14 0.23
15 0.21
16 0.13
17 0.11
18 0.1
19 0.09
20 0.09
21 0.08
22 0.08
23 0.06
24 0.06
25 0.06
26 0.09
27 0.13
28 0.17
29 0.19
30 0.26
31 0.31
32 0.37
33 0.4
34 0.39
35 0.38
36 0.39
37 0.44
38 0.4
39 0.38
40 0.36
41 0.33
42 0.32
43 0.31
44 0.25
45 0.19
46 0.18
47 0.15
48 0.12
49 0.11
50 0.11
51 0.1
52 0.11
53 0.11
54 0.09
55 0.09
56 0.1
57 0.1
58 0.1
59 0.09
60 0.08
61 0.11
62 0.18
63 0.25
64 0.33
65 0.4
66 0.5
67 0.59
68 0.7
69 0.78
70 0.83
71 0.83
72 0.85
73 0.85
74 0.85
75 0.87
76 0.87
77 0.84
78 0.82
79 0.79
80 0.7
81 0.69
82 0.66
83 0.64
84 0.61
85 0.61
86 0.56
87 0.52
88 0.52
89 0.46
90 0.43
91 0.35
92 0.28
93 0.21
94 0.18
95 0.18
96 0.17
97 0.2
98 0.21
99 0.25
100 0.33
101 0.4
102 0.5
103 0.55
104 0.64
105 0.66
106 0.66
107 0.65
108 0.59
109 0.52
110 0.45
111 0.4
112 0.31
113 0.24
114 0.2
115 0.15
116 0.15
117 0.14
118 0.11