Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0N402

Protein Details
Accession A0A0L0N402   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-89QPQAPWKNERRDERRLAKDRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8cyto 8cyto_mito 8, extr 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLARHKAANAALTGAGIMGGAIYMGLRWDGKIGDSLVTIETAQDGAHDPTDEGSTSTSASITSTPNGVQPQAPWKNERRDERRLAKDRVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.05
4 0.04
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.03
13 0.04
14 0.04
15 0.05
16 0.05
17 0.06
18 0.08
19 0.08
20 0.08
21 0.08
22 0.09
23 0.08
24 0.08
25 0.08
26 0.06
27 0.05
28 0.05
29 0.04
30 0.04
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.12
53 0.14
54 0.14
55 0.13
56 0.14
57 0.24
58 0.3
59 0.33
60 0.35
61 0.42
62 0.51
63 0.59
64 0.67
65 0.65
66 0.67
67 0.74
68 0.79
69 0.82
70 0.81