Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0MZR8

Protein Details
Accession A0A0L0MZR8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-105EKAKVPKGRALKRLKYTRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
77-97PKVEPQEKAKVPKGRALKRLK
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences YVTVGGATSPAKFIRQGSRSPHSREFASRPQPFVKFHENLTAPPPTSPSTSSPNKSITMGKVHGSLARAGKVKSQTPKVEPQEKAKVPKGRALKRLKYTRRFVNVTLTGGKRKMNPNPGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.35
4 0.41
5 0.49
6 0.54
7 0.59
8 0.62
9 0.56
10 0.55
11 0.55
12 0.54
13 0.55
14 0.58
15 0.54
16 0.51
17 0.53
18 0.53
19 0.5
20 0.49
21 0.47
22 0.38
23 0.36
24 0.4
25 0.36
26 0.33
27 0.34
28 0.31
29 0.23
30 0.22
31 0.23
32 0.17
33 0.18
34 0.19
35 0.19
36 0.23
37 0.28
38 0.3
39 0.3
40 0.31
41 0.3
42 0.29
43 0.28
44 0.24
45 0.23
46 0.22
47 0.2
48 0.18
49 0.18
50 0.17
51 0.16
52 0.17
53 0.14
54 0.16
55 0.17
56 0.16
57 0.19
58 0.21
59 0.25
60 0.28
61 0.34
62 0.35
63 0.38
64 0.47
65 0.5
66 0.55
67 0.53
68 0.55
69 0.58
70 0.58
71 0.6
72 0.59
73 0.59
74 0.52
75 0.56
76 0.59
77 0.57
78 0.62
79 0.66
80 0.66
81 0.7
82 0.78
83 0.82
84 0.81
85 0.81
86 0.81
87 0.8
88 0.75
89 0.67
90 0.66
91 0.6
92 0.54
93 0.54
94 0.47
95 0.44
96 0.42
97 0.44
98 0.4
99 0.45
100 0.5