Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0N5W2

Protein Details
Accession A0A0L0N5W2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
106-131EDKARVLEKTKKRNTHFPQRKFAVKAHydrophilic
NLS Segment(s)
PositionSequence
92-126RPKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MVSPRCPPSSGKVKAVQLWDKSKDDLTKQLAELKTELGQLRIQKIASSGTKLNKIHDLRKSIARVLTVINAKQRSQLRLFYKNKKYAPLDLRPKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRKFAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.58
4 0.55
5 0.56
6 0.55
7 0.51
8 0.48
9 0.48
10 0.44
11 0.4
12 0.41
13 0.39
14 0.37
15 0.35
16 0.41
17 0.37
18 0.35
19 0.32
20 0.26
21 0.23
22 0.23
23 0.22
24 0.16
25 0.18
26 0.19
27 0.2
28 0.2
29 0.19
30 0.16
31 0.16
32 0.19
33 0.17
34 0.18
35 0.2
36 0.21
37 0.28
38 0.29
39 0.29
40 0.33
41 0.35
42 0.38
43 0.39
44 0.41
45 0.36
46 0.41
47 0.41
48 0.35
49 0.33
50 0.27
51 0.23
52 0.19
53 0.2
54 0.17
55 0.16
56 0.19
57 0.19
58 0.19
59 0.24
60 0.26
61 0.26
62 0.27
63 0.33
64 0.34
65 0.43
66 0.5
67 0.54
68 0.6
69 0.64
70 0.64
71 0.63
72 0.6
73 0.59
74 0.59
75 0.59
76 0.61
77 0.59
78 0.67
79 0.64
80 0.63
81 0.61
82 0.61
83 0.62
84 0.6
85 0.64
86 0.61
87 0.65
88 0.71
89 0.74
90 0.74
91 0.73
92 0.74
93 0.72
94 0.67
95 0.63
96 0.57
97 0.53
98 0.52
99 0.53
100 0.53
101 0.56
102 0.63
103 0.7
104 0.74
105 0.79
106 0.82
107 0.83
108 0.85
109 0.82
110 0.83
111 0.8
112 0.82