Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0N3W1

Protein Details
Accession A0A0L0N3W1    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-52PDGPWRRKVTKIKKDLIHKAKVBasic
NLS Segment(s)
PositionSequence
33-64GPWRRKVTKIKKDLIHKAKVKKEYAKIKAREQ
168-209EERIREMERRREERERRMTERERLKKAIAKTRDKDGRKKLGR
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MAPKRAFEASEPDSASMKPKRGFRVGPDNLPDGPWRRKVTKIKKDLIHKAKVKKEYAKIKAREQETXARAARKNTAAAHDEPDHQDAERDAVQSENENESTAQEDEQPMHPTRELMLKDEEMAQVGAGAKPEGTETATTSDGNRRRTRRPGYYDKQLEKAEQKRVEAEERIREMERRREERERRMTERERLKKAIAKTRDKDGRKKLGRESTLLLDKVKRLVSEGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.32
4 0.36
5 0.35
6 0.4
7 0.46
8 0.52
9 0.55
10 0.55
11 0.61
12 0.59
13 0.61
14 0.59
15 0.55
16 0.48
17 0.46
18 0.42
19 0.38
20 0.38
21 0.39
22 0.41
23 0.41
24 0.5
25 0.6
26 0.67
27 0.7
28 0.74
29 0.75
30 0.76
31 0.82
32 0.84
33 0.82
34 0.8
35 0.77
36 0.76
37 0.76
38 0.76
39 0.73
40 0.71
41 0.71
42 0.71
43 0.73
44 0.74
45 0.71
46 0.71
47 0.72
48 0.66
49 0.64
50 0.57
51 0.55
52 0.51
53 0.55
54 0.5
55 0.47
56 0.46
57 0.42
58 0.41
59 0.36
60 0.33
61 0.28
62 0.29
63 0.26
64 0.29
65 0.27
66 0.28
67 0.26
68 0.26
69 0.22
70 0.18
71 0.17
72 0.13
73 0.14
74 0.12
75 0.11
76 0.1
77 0.1
78 0.1
79 0.11
80 0.12
81 0.11
82 0.1
83 0.1
84 0.1
85 0.1
86 0.12
87 0.11
88 0.09
89 0.08
90 0.08
91 0.09
92 0.11
93 0.14
94 0.13
95 0.14
96 0.14
97 0.13
98 0.14
99 0.18
100 0.16
101 0.15
102 0.16
103 0.15
104 0.15
105 0.16
106 0.15
107 0.11
108 0.1
109 0.07
110 0.06
111 0.07
112 0.06
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.09
123 0.1
124 0.1
125 0.11
126 0.18
127 0.23
128 0.29
129 0.36
130 0.38
131 0.44
132 0.53
133 0.6
134 0.62
135 0.66
136 0.69
137 0.69
138 0.75
139 0.77
140 0.71
141 0.69
142 0.61
143 0.56
144 0.54
145 0.53
146 0.52
147 0.46
148 0.44
149 0.41
150 0.43
151 0.43
152 0.4
153 0.39
154 0.37
155 0.37
156 0.39
157 0.37
158 0.38
159 0.39
160 0.44
161 0.49
162 0.48
163 0.52
164 0.6
165 0.67
166 0.73
167 0.78
168 0.76
169 0.73
170 0.77
171 0.77
172 0.75
173 0.78
174 0.77
175 0.73
176 0.69
177 0.68
178 0.64
179 0.65
180 0.66
181 0.65
182 0.66
183 0.62
184 0.69
185 0.73
186 0.74
187 0.76
188 0.76
189 0.78
190 0.76
191 0.79
192 0.78
193 0.79
194 0.75
195 0.7
196 0.64
197 0.61
198 0.59
199 0.54
200 0.48
201 0.41
202 0.39
203 0.4
204 0.38
205 0.3