Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0N2Y1

Protein Details
Accession A0A0L0N2Y1   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-56QMPSMQRRSCPPCPRKARRPSNSCPRPLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016543  Fis1  
IPR033745  Fis1_cytosol  
IPR028061  Fis1_TPR_C  
IPR028058  Fis1_TPR_N  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
GO:0000266  P:mitochondrial fission  
Pfam View protein in Pfam  
PF14853  Fis1_TPR_C  
PF14852  Fis1_TPR_N  
CDD cd12212  Fis1  
Amino Acid Sequences MVAELPCEPRAPDLPAAEDVNADRRRRQMPSMQRRSCPPCPRKARRPSNSCPRPLSPSELNVLRAQYDKEGEMGLVKSNQRNDQQLGVRLLSDIFRLSPERRRECLYYLALGNYKLGNYGEARRYNDLLIDKEPANLQASDLRQLIDNKVAKEGLMGVAILSGVGIAAGVIGALIFKNARRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.31
4 0.27
5 0.25
6 0.21
7 0.26
8 0.3
9 0.29
10 0.29
11 0.33
12 0.38
13 0.41
14 0.46
15 0.46
16 0.52
17 0.62
18 0.69
19 0.7
20 0.68
21 0.72
22 0.75
23 0.75
24 0.75
25 0.71
26 0.7
27 0.75
28 0.81
29 0.83
30 0.86
31 0.87
32 0.87
33 0.88
34 0.88
35 0.88
36 0.86
37 0.82
38 0.77
39 0.69
40 0.65
41 0.59
42 0.56
43 0.47
44 0.41
45 0.39
46 0.35
47 0.34
48 0.29
49 0.26
50 0.21
51 0.19
52 0.17
53 0.14
54 0.14
55 0.12
56 0.11
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.1
63 0.12
64 0.14
65 0.16
66 0.21
67 0.22
68 0.24
69 0.25
70 0.27
71 0.27
72 0.29
73 0.28
74 0.24
75 0.21
76 0.18
77 0.17
78 0.12
79 0.1
80 0.07
81 0.05
82 0.06
83 0.09
84 0.11
85 0.18
86 0.27
87 0.32
88 0.34
89 0.37
90 0.38
91 0.38
92 0.42
93 0.36
94 0.29
95 0.25
96 0.24
97 0.21
98 0.19
99 0.17
100 0.12
101 0.1
102 0.09
103 0.09
104 0.08
105 0.09
106 0.14
107 0.19
108 0.23
109 0.26
110 0.28
111 0.29
112 0.28
113 0.29
114 0.28
115 0.24
116 0.21
117 0.21
118 0.19
119 0.19
120 0.19
121 0.17
122 0.17
123 0.15
124 0.14
125 0.16
126 0.17
127 0.2
128 0.2
129 0.18
130 0.19
131 0.21
132 0.22
133 0.25
134 0.27
135 0.24
136 0.27
137 0.26
138 0.23
139 0.22
140 0.21
141 0.14
142 0.11
143 0.1
144 0.07
145 0.07
146 0.07
147 0.06
148 0.04
149 0.03
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.04
162 0.05