Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0N4H3

Protein Details
Accession A0A0L0N4H3   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
232-251VRASKMRKQKEVKSRVERDSHydrophilic
NLS Segment(s)
PositionSequence
234-244ASKMRKQKEVK
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006565  BTP  
IPR009072  Histone-fold  
IPR037818  TAF8  
IPR019473  TFIID_su8_C  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF07524  Bromo_TP  
PF10406  TAF8_C  
CDD cd08049  TAF8  
Amino Acid Sequences MSAKRILPPEDGPESDSKRPKVDAQKASAPQDVPVVLGIDGQGGVSAATEFLAPSHHHHARCGIQRSIALVLKHDGFASASPQAMESFTGLVESYLESIIEETKRFAMSARREHPIPSDFELMLRHHNLTTASLKPHLKNPISKKDLAPTYSTVTATDDDALTTLPLLSAELSGQADKDAMRHIPPSFPDFPSRHTYRFTPQEDTGARVSQKIREEAARTAQHGEDALRRLVRASKMRKQKEVKSRVERDSQGKERFRLWEATMKRFMGAXGGGGDSEQVEIADHNMIVNGDAAFSRKEVSRLGKRLGGLSANGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.51
4 0.48
5 0.46
6 0.48
7 0.54
8 0.57
9 0.61
10 0.61
11 0.6
12 0.67
13 0.68
14 0.7
15 0.65
16 0.55
17 0.45
18 0.4
19 0.33
20 0.24
21 0.19
22 0.16
23 0.11
24 0.11
25 0.1
26 0.07
27 0.07
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.07
40 0.08
41 0.13
42 0.22
43 0.27
44 0.28
45 0.29
46 0.35
47 0.4
48 0.47
49 0.49
50 0.42
51 0.39
52 0.39
53 0.4
54 0.39
55 0.35
56 0.26
57 0.22
58 0.22
59 0.21
60 0.21
61 0.18
62 0.14
63 0.11
64 0.11
65 0.12
66 0.11
67 0.1
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.08
74 0.07
75 0.06
76 0.07
77 0.06
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.08
87 0.09
88 0.09
89 0.09
90 0.1
91 0.11
92 0.11
93 0.12
94 0.18
95 0.24
96 0.33
97 0.36
98 0.37
99 0.38
100 0.39
101 0.41
102 0.36
103 0.33
104 0.27
105 0.26
106 0.23
107 0.23
108 0.24
109 0.21
110 0.22
111 0.2
112 0.17
113 0.14
114 0.15
115 0.15
116 0.15
117 0.17
118 0.16
119 0.16
120 0.2
121 0.23
122 0.23
123 0.27
124 0.32
125 0.32
126 0.37
127 0.43
128 0.49
129 0.5
130 0.51
131 0.47
132 0.46
133 0.46
134 0.41
135 0.35
136 0.27
137 0.25
138 0.25
139 0.24
140 0.18
141 0.15
142 0.14
143 0.12
144 0.11
145 0.08
146 0.06
147 0.06
148 0.06
149 0.04
150 0.04
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.04
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.06
166 0.07
167 0.07
168 0.08
169 0.11
170 0.11
171 0.13
172 0.15
173 0.2
174 0.22
175 0.22
176 0.28
177 0.26
178 0.3
179 0.36
180 0.38
181 0.34
182 0.34
183 0.35
184 0.35
185 0.43
186 0.42
187 0.4
188 0.37
189 0.42
190 0.4
191 0.4
192 0.35
193 0.29
194 0.26
195 0.24
196 0.24
197 0.23
198 0.25
199 0.24
200 0.24
201 0.25
202 0.28
203 0.28
204 0.34
205 0.31
206 0.29
207 0.3
208 0.28
209 0.25
210 0.22
211 0.21
212 0.17
213 0.18
214 0.19
215 0.17
216 0.17
217 0.18
218 0.22
219 0.27
220 0.32
221 0.38
222 0.44
223 0.54
224 0.6
225 0.68
226 0.71
227 0.74
228 0.76
229 0.78
230 0.8
231 0.8
232 0.82
233 0.78
234 0.78
235 0.74
236 0.7
237 0.7
238 0.68
239 0.67
240 0.64
241 0.61
242 0.57
243 0.55
244 0.51
245 0.46
246 0.4
247 0.4
248 0.4
249 0.45
250 0.46
251 0.43
252 0.4
253 0.35
254 0.32
255 0.25
256 0.2
257 0.14
258 0.1
259 0.1
260 0.09
261 0.09
262 0.1
263 0.08
264 0.07
265 0.06
266 0.05
267 0.05
268 0.06
269 0.08
270 0.07
271 0.07
272 0.08
273 0.08
274 0.08
275 0.09
276 0.08
277 0.07
278 0.07
279 0.09
280 0.09
281 0.1
282 0.12
283 0.12
284 0.15
285 0.2
286 0.29
287 0.38
288 0.44
289 0.48
290 0.5
291 0.49
292 0.5
293 0.48
294 0.41