Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NG97

Protein Details
Accession A0A0L0NG97    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-69VDENGRRRRWRRRETPETGSGBasic
NLS Segment(s)
PositionSequence
54-60RRRRWRR
Subcellular Location(s) plas 8, extr 6, E.R. 5, mito 4, golg 3
Family & Domain DBs
Amino Acid Sequences MPPHLHPRSRMTSSLFATTVVASFFVVALPHILPCPVPRTKYADGEVIVDENGRRRRWRRRETPETGSGIVQFNQAAEDDTYSAVERTKRECPVPKPGGMLGEWLGFHKHDGQTGKRVDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.3
5 0.26
6 0.21
7 0.14
8 0.11
9 0.07
10 0.07
11 0.06
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.07
19 0.07
20 0.07
21 0.08
22 0.14
23 0.16
24 0.17
25 0.19
26 0.27
27 0.3
28 0.34
29 0.34
30 0.32
31 0.29
32 0.29
33 0.27
34 0.19
35 0.16
36 0.12
37 0.1
38 0.13
39 0.17
40 0.18
41 0.23
42 0.29
43 0.4
44 0.51
45 0.61
46 0.65
47 0.71
48 0.79
49 0.81
50 0.81
51 0.75
52 0.67
53 0.58
54 0.47
55 0.38
56 0.3
57 0.23
58 0.17
59 0.11
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.07
66 0.07
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.12
73 0.13
74 0.17
75 0.23
76 0.26
77 0.33
78 0.41
79 0.43
80 0.51
81 0.54
82 0.52
83 0.49
84 0.47
85 0.43
86 0.35
87 0.32
88 0.22
89 0.19
90 0.17
91 0.15
92 0.15
93 0.13
94 0.14
95 0.18
96 0.18
97 0.22
98 0.28
99 0.31
100 0.38