Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0MXL2

Protein Details
Accession A0A0L0MXL2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
90-113ECRFLAKKMPRHKKSDKPLPPEVLHydrophilic
NLS Segment(s)
PositionSequence
101-104RHKK
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTALASTTIPLKRKAEADAQPVSLPPSKPAPSPELQPASRDQHAPLDDALRHPRFSAPEARSLLAIVRENHRRRLYLPPLLWTAEQVELXECRFLAKKMPRHKKSDKPLPPEVLPEDGRELPKSPVTARDYAIQAAISLSGLGVVNARISAVIDLLAPFNFKYAPTSLSFFFDRNRYVTCLRAATLFASESAPPSLAYINLDRLHPLRIEYYREKFRPCFHDKRRARYNDPVSRLMWKKLGKLKPENEVEDPYIVAVLIALAQIAARSTPVSESAESQHGDPAASEQMPSLPKAFKVHVLAMPYTATRKIYLYTACFPATFLDKLDQPSRFSPCEPVTIAYYALPLRHPMLLQGLALALRAPTSSTKRGVSVGEAFGDAVTVNLVRKLELSVYMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.45
4 0.48
5 0.47
6 0.47
7 0.43
8 0.41
9 0.41
10 0.37
11 0.31
12 0.27
13 0.3
14 0.3
15 0.33
16 0.37
17 0.39
18 0.36
19 0.41
20 0.47
21 0.47
22 0.45
23 0.45
24 0.47
25 0.46
26 0.47
27 0.43
28 0.36
29 0.36
30 0.36
31 0.35
32 0.31
33 0.29
34 0.27
35 0.31
36 0.38
37 0.33
38 0.33
39 0.32
40 0.34
41 0.32
42 0.35
43 0.4
44 0.34
45 0.39
46 0.42
47 0.41
48 0.37
49 0.34
50 0.32
51 0.27
52 0.28
53 0.22
54 0.26
55 0.36
56 0.4
57 0.48
58 0.49
59 0.47
60 0.45
61 0.53
62 0.55
63 0.54
64 0.52
65 0.47
66 0.47
67 0.47
68 0.44
69 0.35
70 0.29
71 0.22
72 0.2
73 0.16
74 0.17
75 0.15
76 0.16
77 0.15
78 0.13
79 0.12
80 0.12
81 0.2
82 0.24
83 0.32
84 0.42
85 0.53
86 0.59
87 0.69
88 0.77
89 0.79
90 0.82
91 0.85
92 0.83
93 0.8
94 0.81
95 0.76
96 0.68
97 0.63
98 0.54
99 0.48
100 0.39
101 0.33
102 0.29
103 0.26
104 0.26
105 0.23
106 0.23
107 0.2
108 0.21
109 0.21
110 0.19
111 0.24
112 0.27
113 0.28
114 0.27
115 0.29
116 0.28
117 0.27
118 0.26
119 0.18
120 0.14
121 0.11
122 0.1
123 0.06
124 0.05
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.05
143 0.06
144 0.05
145 0.06
146 0.06
147 0.06
148 0.08
149 0.08
150 0.11
151 0.12
152 0.14
153 0.15
154 0.17
155 0.18
156 0.17
157 0.18
158 0.18
159 0.18
160 0.17
161 0.18
162 0.19
163 0.19
164 0.21
165 0.21
166 0.19
167 0.18
168 0.17
169 0.16
170 0.13
171 0.12
172 0.1
173 0.08
174 0.09
175 0.08
176 0.08
177 0.08
178 0.08
179 0.07
180 0.07
181 0.07
182 0.06
183 0.07
184 0.07
185 0.11
186 0.12
187 0.12
188 0.12
189 0.13
190 0.14
191 0.13
192 0.13
193 0.12
194 0.13
195 0.19
196 0.23
197 0.28
198 0.34
199 0.36
200 0.39
201 0.38
202 0.42
203 0.45
204 0.48
205 0.53
206 0.53
207 0.62
208 0.63
209 0.7
210 0.75
211 0.73
212 0.71
213 0.7
214 0.73
215 0.7
216 0.69
217 0.63
218 0.54
219 0.55
220 0.51
221 0.44
222 0.4
223 0.34
224 0.35
225 0.42
226 0.46
227 0.47
228 0.53
229 0.54
230 0.56
231 0.58
232 0.56
233 0.49
234 0.46
235 0.39
236 0.31
237 0.27
238 0.19
239 0.14
240 0.1
241 0.07
242 0.04
243 0.03
244 0.03
245 0.03
246 0.02
247 0.02
248 0.02
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.04
255 0.05
256 0.07
257 0.1
258 0.1
259 0.12
260 0.14
261 0.18
262 0.18
263 0.18
264 0.18
265 0.16
266 0.15
267 0.13
268 0.13
269 0.12
270 0.11
271 0.11
272 0.09
273 0.13
274 0.14
275 0.15
276 0.15
277 0.14
278 0.16
279 0.19
280 0.2
281 0.21
282 0.24
283 0.27
284 0.27
285 0.29
286 0.27
287 0.24
288 0.24
289 0.2
290 0.19
291 0.17
292 0.16
293 0.14
294 0.14
295 0.15
296 0.18
297 0.21
298 0.24
299 0.26
300 0.28
301 0.28
302 0.27
303 0.26
304 0.24
305 0.24
306 0.2
307 0.17
308 0.17
309 0.19
310 0.24
311 0.29
312 0.29
313 0.29
314 0.33
315 0.37
316 0.37
317 0.36
318 0.38
319 0.35
320 0.37
321 0.35
322 0.32
323 0.3
324 0.28
325 0.27
326 0.2
327 0.21
328 0.17
329 0.17
330 0.15
331 0.14
332 0.15
333 0.16
334 0.16
335 0.15
336 0.19
337 0.19
338 0.18
339 0.16
340 0.15
341 0.13
342 0.13
343 0.12
344 0.07
345 0.06
346 0.06
347 0.08
348 0.13
349 0.2
350 0.25
351 0.29
352 0.31
353 0.32
354 0.35
355 0.35
356 0.34
357 0.32
358 0.29
359 0.26
360 0.24
361 0.23
362 0.2
363 0.18
364 0.13
365 0.08
366 0.07
367 0.07
368 0.07
369 0.1
370 0.1
371 0.11
372 0.12
373 0.14
374 0.14