Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NK47

Protein Details
Accession A0A0L0NK47   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-47SAKPSDKKEPEAKPAPKKRARAAPTTTRARKKTRQEEETHydrophilic
54-73SSRKGAKSIKETKRDFRKKTBasic
NLS Segment(s)
PositionSequence
12-72PSDKKEPEAKPAPKKRARAAPTTTRARKKTRQEEETADEGRNSSRKGAKSIKETKRDFRKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPTKLTPMSAKPSDKKEPEAKPAPKKRARAAPTTTRARKKTRQEEETADEGRNSSRKGAKSIKETKRDFRKKTDEVTKLIEKQLRSELSASEQPPVVESLPPDFASFLPYAASNIPIVAEIQNTTYKKAQECLIHFQAMVKEYETVNKCSTDIKPPTWVLWEQDTKDLRALNENSLSLAFNNLNSIVMPNAKGRLVEEPAKDGDDIGAMALELLAGAKPNRGEETWGAVAQGFLRALSGAARLLPKTGES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.66
4 0.66
5 0.68
6 0.72
7 0.73
8 0.74
9 0.8
10 0.83
11 0.82
12 0.82
13 0.81
14 0.81
15 0.77
16 0.75
17 0.73
18 0.72
19 0.73
20 0.77
21 0.77
22 0.76
23 0.78
24 0.78
25 0.79
26 0.79
27 0.81
28 0.81
29 0.79
30 0.76
31 0.76
32 0.73
33 0.7
34 0.61
35 0.5
36 0.4
37 0.34
38 0.31
39 0.27
40 0.22
41 0.22
42 0.26
43 0.28
44 0.35
45 0.43
46 0.45
47 0.52
48 0.62
49 0.65
50 0.68
51 0.71
52 0.73
53 0.76
54 0.8
55 0.76
56 0.75
57 0.75
58 0.7
59 0.74
60 0.75
61 0.68
62 0.61
63 0.63
64 0.58
65 0.52
66 0.52
67 0.46
68 0.36
69 0.34
70 0.37
71 0.32
72 0.28
73 0.25
74 0.21
75 0.22
76 0.27
77 0.25
78 0.19
79 0.19
80 0.17
81 0.17
82 0.18
83 0.14
84 0.1
85 0.1
86 0.1
87 0.12
88 0.12
89 0.12
90 0.11
91 0.1
92 0.12
93 0.12
94 0.1
95 0.08
96 0.08
97 0.09
98 0.08
99 0.09
100 0.06
101 0.06
102 0.06
103 0.05
104 0.06
105 0.05
106 0.05
107 0.05
108 0.06
109 0.11
110 0.11
111 0.13
112 0.15
113 0.17
114 0.17
115 0.18
116 0.21
117 0.21
118 0.24
119 0.29
120 0.29
121 0.27
122 0.27
123 0.26
124 0.24
125 0.21
126 0.18
127 0.11
128 0.1
129 0.1
130 0.17
131 0.18
132 0.19
133 0.19
134 0.19
135 0.19
136 0.21
137 0.22
138 0.25
139 0.27
140 0.25
141 0.29
142 0.3
143 0.3
144 0.3
145 0.3
146 0.23
147 0.25
148 0.27
149 0.24
150 0.3
151 0.3
152 0.28
153 0.29
154 0.28
155 0.22
156 0.26
157 0.26
158 0.22
159 0.23
160 0.22
161 0.2
162 0.19
163 0.19
164 0.12
165 0.13
166 0.1
167 0.08
168 0.09
169 0.09
170 0.09
171 0.08
172 0.09
173 0.08
174 0.09
175 0.1
176 0.1
177 0.12
178 0.13
179 0.13
180 0.13
181 0.17
182 0.2
183 0.25
184 0.24
185 0.26
186 0.27
187 0.28
188 0.26
189 0.21
190 0.17
191 0.12
192 0.1
193 0.07
194 0.06
195 0.04
196 0.04
197 0.04
198 0.03
199 0.03
200 0.03
201 0.03
202 0.05
203 0.05
204 0.08
205 0.09
206 0.12
207 0.15
208 0.15
209 0.2
210 0.2
211 0.27
212 0.27
213 0.27
214 0.25
215 0.22
216 0.22
217 0.18
218 0.19
219 0.11
220 0.08
221 0.08
222 0.08
223 0.08
224 0.09
225 0.1
226 0.08
227 0.11
228 0.13
229 0.13
230 0.15