Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0NIT1

Protein Details
Accession A0A0L0NIT1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-73WYIHFATLKPEQKKKKKPKDNAKGGPGKKBasic
NLS Segment(s)
PositionSequence
55-73EQKKKKKPKDNAKGGPGKK
Subcellular Location(s) cyto 10.5, cyto_nucl 6.5, extr 5, E.R. 4, mito 2, vacu 2, nucl 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANFDWLKSVGATNEAVAVLNDQPNLFVNLLVVLVGLIVQCLLIWYIHFATLKPEQKKKKKPKDNAKGGPGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.1
6 0.09
7 0.1
8 0.1
9 0.09
10 0.09
11 0.1
12 0.12
13 0.11
14 0.09
15 0.08
16 0.07
17 0.07
18 0.06
19 0.05
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.03
32 0.05
33 0.06
34 0.08
35 0.08
36 0.08
37 0.13
38 0.21
39 0.29
40 0.34
41 0.43
42 0.52
43 0.63
44 0.74
45 0.81
46 0.84
47 0.87
48 0.91
49 0.94
50 0.94
51 0.95
52 0.94
53 0.93